scieee Science in your language
[en] (orig)

Engineering of specific bacteriophages for α-Synucleinopathies diagnosis

Abstract

As α-sinucleinopatias são doenças neurodegenerativas caracterizadas por depósitos anormais de agregados de α-sinucleína em neurónios ou células gliais, capazes de provocar demência e perturbações do movimento, especialmente em pessoas idosas. De acordo com a ordem de prevalência, as três principais α-sinucleinopatias são a doença de Parkinson, demência com corpos de Lewy e atrofia de múltiplos sistemas. A acumulação de α-sinucleína nos neurónios, resulta nos chamados corpos de Lewy, que são a marca patológica da doença de Parkinson e demência com corpos de Lewy, enquanto a acumulação de α-sinucleína nas células oligodendrogliais dá origem às chamadas inclusões citoplasmáticas gliais, que são a principal característica da atrofia de múltiplos sistemas. Atualmente, estas α-sinucleinopatias não têm qualquer tipo de tratamento ou diagnóstico precoce, pelo que o desenvolvimento de abordagens para diagnóstico e terapêutica são cruciais. Uma vez que a agregação de α-sinucleína é uma característica de todas estas doenças neurodegenerativas, as estratégias que tenham este biomarcador como alvo podem tornar-se terapias promissoras. No entanto, o desenvolvimento de novas estratégias de tratamento e/ou diagnóstico é limitado pela barreira hematoencefálica que reveste o sistema nervoso central. Posto isto, a presente proposta teve como principal objetivo desenvolver um sistema baseado em bacteriófagos (vírus de bactérias) capazes de atravessar a barreira hematoencefálica para diagnosticar α–sinucleinopatias, precocemente. Neste trabalho, bacteriófagos filamentosos M13, foram manipulados geneticamente para fazerem o display à superfície de péptidos (4554: KEGVVHGVAT, 4554W: KDGIVNGVKA e 4554WN6A: KDGIVAGVKA) potencialmente capazes de reconhecerem e se ligarem à α-sinucleína. Os fagos de interesse foram obtidos com sucesso por intermédio da combinação do DNA de um fagemídeo modificado com o DNA do fago aulixiar M13KO7. De modo a avaliar a afinidade dos fagos artificiais com a região 45-54 da α-sinucleína e a caracterizar morfologicamente os fagos aquando desta interação, ensaios de caracterização foram realizados. Os resultados obtidos apenas evidenciaram que os fagos exibiam o respetivo péptido de interesse, e que a nível físico e químico apresentaram um tamanho e uma carga condizente com o que era esperado. Resumidamente, pode dizer-se que os fagos foram obtidos com sucesso, o que abre portas a novas linhas de estudo futuras. Esta ferramenta será um ponto de partida para o diagnóstico precoce e para, possivelmente, um tratamento capaz de travar a progressão destas doenças.

Read accessible full text

Engineering of specific bacteriophages for α-Synucleinopathies diagnosis

Author: Rodrigues, Adriana Sofia Veloso
Year: 2022
Source: https://repositorium.uminho.pt/bitstreams/ee0806b9-d837-4f46-a327-2395e646937a/download
UMinho | 2022
Ad iana So ia Veloso Rod igues
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
Oc obe 2022
Ad iana So ia Veloso Rod igues
Enginee ing O Speci ic Bac e iophages
Fo α-Synucleinopa hies Diagnosis
i
Ad iana So ia Veloso Rod igues
Enginee ing O Speci ic Bac e iophages Fo α-
Synucleinopa hies Diagnosis
Mas e Disse a ion
Mas e ’s Deg ee in Biomedical Enginee ing
Clinical Enginee ing B anch
P ojec supe ised by
Doc o I one Ma isa Pe ei a Ma ins
Oc obe 2022
ii
DIREITOS DE AUTOR E CONDIÇÕES DE UTILIZAÇÃO DO TRABALHO POR TERCEIROS
Es e é um abalho académico que pode se u ilizado po e cei os desde que espei adas as eg as e
boas p á icas in e nacionalmen e acei es, no que conce ne aos di ei os de au o e di ei os conexos.
Assim, o p esen e abalho pode se u ilizado nos e mos p e is os na licença abaixo indicada.
Caso o u ilizado necessi e de pe missão pa a pode aze um uso do abalho em condições não p e is as
no licenciamen o indicado, de e á con ac a o au o , a a és do Reposi ó iUM da Uni e sidade do Minho.
Licença concedida aos u ilizado es des e abalho
A ibuição-NãoCome cial-Compa ilhaIgual
CC BY-NC-SA
h ps://c ea i ecommons.o g/licenses/by-nc-sa/4.0/
iii
AGRADECIMENTOS
Dizem que odos nós somos um pedacinho de odas as pessoas que passam na nossa ida. De uma
manei a ou de ou a, as pessoas deixam a sua pegada em nós e ans o mam-nos sem que às ezes nos
ape cebamos disso. Sem dú ida que ao longo des a longa iagem passa am po mim pessoas que deixa am a
sua ma ca, e o mínimo que lhes de o é um “ob igada”, po isso, as pala as que se seguem são dedicadas a elas.
Emba quei nes e p oje o há um ano e com ela ap endi imenso… es e pa ág a o dedico-o à minha
o ien ado a, I one Ma ins. Fo neces e-me odas as bases e supo e pa a le a es a missão a é ao im. Deixas e-
me “c esce ” mos ando-me que e a az pa e e que o impo an e é en a e não desis i . Ob igada po udo…
“You a e needed” o me.
Dedico aqui ambém, um ag adecimen o ao A u Ribei o po odo o apoio e assis ência écnica nes e
abalho e ao Rica do Pi es pela assis ência com o mic oscópio de o ça a ómica.
E po que po ás de um abalho es á semp e uma g ande equipa, chegou a al u a ce a de ag adece a
odo o g upo L-Phage. A odos eles um eno me ob igada po me e em acolhido ão bem. Que ia apenas deixa
um ag adecimen o especial àqueles que acompanha am mais de pe o e que o am peças undamen ais nes a
jo nada. Um ob igada à Ana B andão, ao Alex, à Cá ia, ao Da id, à Daniela, à Jonhy, à Licinha, à Lu, à Ma a, à
Ri a, à Ru e e, po im, um ob igada à pessoa que ez “babysi ing” nas suas ho as agas, Ma ia, a i o meu
ob igada… ocês são o que de melho le o des a expe iência. Foi um p i ilégio aze pa e des a equipa. L-Phage
ocês são inc í eis.
Às duas meninas que ilha am es es 5 anos lado a lado comigo, ob igada. Po meio de lág imas e so isos
jun as encon amos as saídas de odos os labi in os. Ma y e B u, ocês são mui o impo an es pa a mim… que
con inuemos a b ilha jun as, semp e!
Pa a aqueles que ib am com as minhas conquis as como se ossem as deles, pa a aqueles que mesmo
es ando a quilóme os de dis ância, nunca se esquecem de mim; pa a aqueles que semp e me apoiam
incondicionalmen e… No osso olha ejo o o gulho que sen em po mim, e po isso um ob igada nunca se á
su icien e. Simplesmen e, sou uma a o unada po pe ence à amília que pe enço.
O ag adecimen o mais signi ican e de odos, ai pa a aqueles que me pe mi em odos os dias oa em
di e en es di eções. Mãe e Pai, ob igada! Ob igada po me deixa em se a somb a mais boni a do osso e lexo.
Te mino com o ag adecimen o àquele que i e na con adição comigo, mas que apesa de não demons a sei
que o ce po mim… amo de i mãos é isso mesmo.
“The oo s o wo k may be bi e , bu he ui is swee ” by o une cookie, 2022

i
STATEMENT OF INTEGRITY
I he eby decla e ha ing conduc ed his academic wo k wi h in eg i y. I con i m ha I ha e no used
plagia ism o any o m o undue use o in o ma ion o alsi ica ion o esul s along he p ocess leading o
i s elabo a ion.
I u he decla e ha I ha e ully acknowledge he Code o E hical Conduc o Uni e si y o Minho.
Cons ução De Bac e ió agos Especí icos Pa a O Diagnós ico de α-Sinucleinopa ias
RESUMO
As α-sinucleinopa ias são doenças neu odegene a i as ca ac e izadas po depósi os ano mais
de ag egados de α-sinucleína em neu ónios ou células gliais, capazes de p o oca demência e
pe u bações do mo imen o, especialmen e em pessoas idosas. De aco do com a o dem de p e alência,
as ês p incipais α-sinucleinopa ias são a doença de Pa kinson, demência com co pos de Lewy e a o ia
de múl iplos sis emas. A acumulação de α-sinucleína nos neu ónios, esul a nos chamados co pos de
Lewy, que são a ma ca pa ológica da doença de Pa kinson e demência com co pos de Lewy, enquan o
a acumulação de α-sinucleína nas células oligodend ogliais dá o igem às chamadas inclusões
ci oplasmá icas gliais, que são a p incipal ca ac e ís ica da a o ia de múl iplos sis emas.
A ualmen e, es as α-sinucleinopa ias não êm qualque ipo de a amen o ou diagnós ico
p ecoce, pelo que o desen ol imen o de abo dagens pa a diagnós ico e e apêu ica são c uciais. Uma
ez que a ag egação de α-sinucleína é uma ca ac e ís ica de odas es as doenças neu odegene a i as,
as es a égias que enham es e bioma cado como al o podem o na -se e apias p omisso as. No
en an o, o desen ol imen o de no as es a égias de a amen o e/ou diagnós ico é limi ado pela ba ei a
hema oence álica que e es e o sis ema ne oso cen al.
Pos o is o, a p esen e p opos a e e como p incipal obje i o desen ol e um sis ema baseado
em bac e ió agos ( í us de bac é ias) capazes de a a essa a ba ei a hema oence álica pa a
diagnos ica α–sinucleinopa ias, p ecocemen e. Nes e abalho, bac e ió agos ilamen osos M13, o am
manipulados gene icamen e pa a aze em o display à supe ície de pép idos (4554: KEGVVHGVAT,
4554W: KDGIVNGVKA e 4554WN6A: KDGIVAGVKA) po encialmen e capazes de econhece em e se
liga em à α-sinucleína. Os agos de in e esse o am ob idos com sucesso po in e médio da combinação
do DNA de um agemídeo modi icado com o DNA do ago aulixia M13KO7. De modo a a alia a a inidade
dos agos a i iciais com a egião 45-54 da α-sinucleína e a ca ac e iza mo ologicamen e os agos
aquando des a in e ação, ensaios de ca ac e ização
o am ealizados. Os esul ados ob idos apenas
e idencia am que os agos exibiam o espe i o pép ido de in e esse, e que a ní el ísico e químico
ap esen a am um amanho e uma ca ga condizen e com o que e a espe ado.
Resumidamen e, pode dize -se que os agos o am ob idos com sucesso, o que ab e po as a
no as linhas de es udo u u as. Es a e amen a se á um pon o de pa ida pa a o diagnós ico p ecoce e
pa a, possi elmen e, um a amen o capaz de a a a p og essão des as doenças.
Pala as-cha e: α-sinucleína, α-sinucleinopa ias, bac e ió agos.
i
Enginee ing o speci ic bac e iophages o α-synucleinopa hies diagnosis
ABSTRACT
α-synucleinopa hies a e neu odegene a i e diseases ha p ima ily a ec aging people. These
diseases a e cha ac e ized by abno mal deposi s o α-synuclein agg ega es in neu ons o glial cells, which
cause demen ia and mo emen diso de s. In line wi h he o de o p e alence, he h ee main α-
synucleinopa hies a e Pa kinson's disease, demen ia wi h Lewy bodies, and mul iple sys em a ophy. The
accumula ion o α-synuclein in neu ons esul s in he so-called Lewy bodies, he hallma k o Pa kinson's
disease and demen ia wi h Lewy bodies. In con as , he buildup o α-synuclein in oligodend oglial cells
gi es ise o he so-called glial cy oplasmic inclusions, which a e he de ining cha ac e is ic o mul iple
sys em a ophy.
Cu en ly, hese α-synucleinopa hies a e no ea ly diagnosed and do no ha e any ea men , so
he de elopmen o diagnos ic and he apeu ic app oaches is c ucial. Since α-synuclein is a pa hological
hallma k o all hese neu odegene a i e diseases, he de elopmen o s a egies wi h his bioma ke as a
a ge can be powe ul he apies. Howe e , he de elopmen o new ea men and/o diagnos ic
app oaches is limi ed by he blood-b ain ba ie ha shel e s he cen al ne ous sys em.
The e o e, he p esen p oposal aimed o de elop a sys em based on bac e iophages (bac e ial
i uses) able o c oss he blood-b ain ba ie o ea ly diagnose α-synucleinopa hies. In his wo k,
ilamen ous bac e iophages M13 we e gene ically manipula ed o display a he su ace pep ides (4554:
KEGVVHGVAT, 4554W: KDGIVNGVKA, and 4554WN6A: KDGIVAGVKA) po en ially capable o ecognizing
and binding o α-synuclein. The phages o in e es we e success ully ob ained by combining DNA om a
modi ied phagemid wi h DNA om he helpe phage M13KO7. In o de o e alua e he a ini y o he
enginee ed phages o he 45-54 egion o α-synuclein and o mo phologically cha ac e ize he phages a
he ime o his in e ac ion, cha ac e iza ion assays we e pe o med. The esul s ob ained showed ha
he phages exhibi ed he espec i e pep ide o in e es , and ha a he physicochemical le el p esen ed
a size and cha ge consis en wi h wha was expec ed.
In summa y, i can be said ha he phages we e success ully ob ained, which opens he doo o
new u u e lines o s udy. This ool will be a s epping-s one o ea ly diagnosis and possibly a ea men
capable o hal ing he p og ession o hese diseases.
Keywo ds: α-synuclein, α-synucleinopa hies, bac e iophages.
ii
INDEX
RESUMO ...........................................................................................................................................
ABSTRACT ....................................................................................................................................... i
LIST OF ILLUSTRATIONS ................................................................................................................ x
LIST OF TABLES ............................................................................................................................ xiii
LIST OF ABBREVIATIONS AND ACRONYMS .............................................................................. xi
1. INTRODUCTION .................................................................................................................... 18
1.1. α-Synucleinopa hies ..................................................................................................... 18
a)
Pa kinson´s disease
.................................................................................................. 18
b)
Demen ia wi h Lewy bodies
........................................................................................ 19
c)
Mul iple Sys em A ophy
............................................................................................ 20
1.2. α-Synuclein .................................................................................................................... 21
1.3. Blood-B ain Ba ie ....................................................................................................... 23
1.4. Bac e iophages ............................................................................................................. 24
1.4.1. Phage Display echnology .................................................................................... 25
a)
M13 Phage Gene ic Manipula ion
.................................................................................. 29
b)
M13 Phage Chemical Manipula ion
................................................................................ 29
c)
M13 Phage Applica ions
................................................................................................ 30
1.5. Pep ide Ta ge ing ......................................................................................................... 32
2. MOTIVATION AND OBJECTIVES ......................................................................................... 35
3. MATERIAL AND METHODS .................................................................................................. 36
3.1. De elopmen o phagemids ......................................................................................... 36
3.1.1. Inse syn hesis ...................................................................................................... 36
3.1.2. Cloning p ocess o he inse s in o he phagemid ............................................ 38
a)
Diges ion Reac ion
......................................................................................................... 38
b)
Liga ion
......................................................................................................................... 39
xi
LIST OF ABBREVIATIONS AND ACRONYMS
A
Aβ: Amyloid-β
APS: Ammonium pe sul a e
AS: α-Synuclein
B
BBB: Blood-b ain ba ie
C
CaCl2: Calcium chlo ide
CEA: Ca cinoemb yonic an igen
CECs: Ce eb al endo helial cells
CED: Con ec ion-enhanced deli e y
CNS: Cen al ne ous sys em
CRC: Colo ec al cance
D
DLB: Demen ia wi h Lewy bodies
DLS: Dynamic ligh sca e ing
DMPS: 1,2-dimy is oyl-sn-glyce ol-3-phospho-L-se ine
DNA: Deoxy ibonucleic acid
DOX: Doxo ubicin
E
E. coli
:
Esche ichia coli
EDTA: E hylenediamine e aace ic acid
F
FA: Folic acid

x
FDG-PET: F- luo odeoxyglucose posi on emission omog aphy
F phage: Filamen ous phage
FR: Fola e ecep o
H
HCl: Hyd ogen chlo ide
G
GCIs: Glial cy oplasmic inclusions
GM-CSF: G anulocy e-mac ophage colony-s imula ing ac o
I
IG egion: In e genic egion
IPTG: Isop opyl β-D-1- hiogalac opy anoside
IEP: Isoelec ic poin
L
LB: Lu ia-Be ani medium
LBs: Lewy bodies
M
MgCl2: Magnesium chlo ide
MRI: Magne ic esonance imaging
MSA: Mul iple sys em a ophy
N
NAC: Non-amyloid-componen
NaCl: Sodium chlo ide
P
PCA: P o ein- agmen complemen a ion assay
x i
PCR: Polyme ase chain eac ion
PD: Pa kinson’s disease
PBS: Phospha e bu e ed saline
PDT: Pho odynamic he apy
PEG: Poly(e hylene glycol)
PET: Posi on emission omog aphy
p-S129: Se ine esidue-129
R
RNA: Ribonucleic acid
S
SBP: SPARC-binding pep ide
scF : Single-chain a iable agmen s
SDS-PAGE: Sodium dodecyl sul a e- polyac ylamide gel elec opho esis
SEM: S anda d e o o he mean
SNARE: Soluble N-e hylmale-imide-sensi i e ac o -a achmen p o ein ecep o s
SNCA: Synuclein-alpha gene
SOC: Supe op imal b o h wi h ca aboli e ep ession
SPARC: Sec e ed p o ein, acidic, and ich in cys eine
SPECT: Single-pho on emission compu ed omog aphy
ssDNA: Single-s anded DNA
STEM: Scanning T ansmission Elec on Mic oscopy
T
TBS: T is-bu e ed saline
TE: T is-EDTA
TEM: T ansmission elec on mic oscopy
TEMED: Te ame hyle hylenediamine
TGS: T is- Glycine- SDS
x ii
W
WT: Wild ype
Z
ZnPc: Zinc ph halocyanine
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
INTRODUCTION
18
1. INTRODUCTION
1.1. α-Synucleinopa hies
In he las wo decades α–synuclein (AS) has come in o special ocus. I is conside ed he p o ein
esponsible o igge ing ce ain pa hologies ha cause demen ia and mo emen diso de s, which ha e
a high incidence in he popula ion o e he age o 50-65 yea s old. Thus, in o de o p e alence,
Pa kinson’s disease (PD), demen ia wi h Lewy bodies (DLB), and mul iple sys em a ophy (MSA) a e
neu odegene a i e diseases ha belong o he amily o α-synucleinopa hies since hey a e cha ac e ized
by abno mal deposi s o AS agg ega es in neu ons o glial cells [1] – [5].
AS agg ega ion in he neu ons esul s in abno mal deposi s called Lewy bodies (LBs). LBs a e
p esen in many egions o he b ain (neoco ex, o eb ain, b ains em and o he pa s o he ne ous
sys em essen ially in
subs an ia nig a pa s compac a
), leading o chemical modi ica ions ha migh
induce p oblems wi h hinking, beha io , mood and mo emen . LBs a e sphe ical (5-25 µm in diame e )
in aneu al cy oplasmic inclusions, mos ly consis ing o AS p o ein agg ega es su ounding hei dense
nucleus. Mo eo e , hey a e a pa hological hallma k o PD and DLB [3], [6] – [8]. None heless, hey can
be dis inguished by he LBs dis ibu ion. LBs a e localized in he mid-b ain, mo e p ecisely in he
subs an ia nig a
in PD, and in ce eb al co ex a ea in DLB [9], [10].
Howe e , he accumula ion o AS in oligodend oglial cells, p esen in he cen al ne ous sys em
(CNS), is known as glial cy oplasmic inclusions (GCIs). These inclusions, which a e a gy ophilic ib illa y
s uc u es composed o mis olded α-synuclein, a e he mos dis inguishing ea u e o MSA [3], [11], [12].
a)
Pa kinson´s disease
Pa kinson's disease (PD) is he second mos common neu odegene a i e disease a e
Alzheime ´s disease, a ec ing mo e han 6 million people, being his numbe expec ed o double by
2050 [13], [14]. S a is ical da a show ha since 1990, PD cases ha e almos ipled, as om 2.5 million
people diagnosed wi h PD o a o al o 6.1 million people in 2016. In 2019, mo e han 8.5 million
indi iduals wo ldwide we e li ing wi h PD, ep esen ing an e en la ge popula ion han he p e iously
epo ed cases o PD in 2016 [15], [16]. This α-synucleinopa hy is cha ac e ized by a massi e loss o
dopamine gic neu ons in he
subs an ia nig a
, which leads o he appea ance o he ou classic mo o
symp oms o his disease: s i ness, gai dis u bance wi h pos u al ins abili y, es emo and b adykinesia
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
INTRODUCTION
19
(di icul y in ini ia ing mo emen s, which in u n a e slow). The main isk ac o o PD is age, bu
en i onmen al ac o s can also be associa ed. In e ms o gende , his disease has a 1.5–2 imes highe
p e alence and incidence in men han in women. In addi ion, women end o demons a e mild symp oms
wi h a slowe p og ession o mo o diso de s bu ha e a highe a e o emo , abou 67%
s
48% in men
[17]–[21].
Nowadays, only 4% o diagnoses a e made in pa ien s unde 50 yea s o age [14]. The diagnosis
o Pa kinson's disease is made on he basis o clinical symp oms. Ne e heless, o ule ou o he
condi ions, magne ic esonance imaging (MRI) is o en used o e alua e he ana omy and s uc u al
pa hology o he b ain so ha pa e ns o s uc u al deg ada ion can be ound o induce a co ec
diagnosis. In addi ion o MRI, o he imaging s udies such as single-pho on emission compu ed
omog aphy (SPECT) can be pe o med. This echnique is use ul o assessing he in eg i y o he
nig os ia al dopamine gic pa hways, which in cases o PD a e ound o be dys unc ional. Mo eo e ,
labo a o y es s can also help diagnose PD, al hough he e a e s ill no speci ic es s o his disease [20],
[22].
Cu en ly, no neu o he apy can ea , slow down and/o p e en his ch onic disease. Al hough
he e is s ill no cu e o Pa kinson's disease, he e a e some d ugs o alle ia e some o he symp oms.
The d ugs a e used o inc ease he le el o dopamine in he b ain (e.g. Le odopa), a ec o he neu onal
chemicals (e.g. En acapone), o help con ol emo symp oms (e.g. Benzo opine) [20].
b)
Demen ia wi h Lewy bodies
Wo ldwide, many cases o demen ia a e diagnosed e e y day. Demen ia is de ined as a loss o
cogni i e abili y ha nega i ely impac s he no mal unc ions o people's daily ou ines. The e a e many
kinds o demen ia, namely demen ia wi h Lewy bodies (DLB), a p og essi e disease, which means ha
symp oms s a slowly and wo sen o e ime. A e Alzheime ´s disease, i is he second mos common
o m o demen ia accoun ing o 20% o demen ia wo ldwide, mainly in he age g oup o 65 yea s and
olde , wi h males being mo e a ec ed [2], [23]–[27]. A he symp oma ic le el, DLB causes dis u bances
in a en ion, mo emen , isuospa ial skills, and memo y ecall. Pa ien s wi h DLB commonly p esen
psychia ic and beha io al dys unc ions such as sleep dis u bances, hallucina ions, and apa hy. In cases
o DLB, cogni i e symp oms p ecede mo o symp oms [20], [23].
Diagnosing DLB has been a challenge, bu his is essen ially done by conside ing he symp om
cha ac e is ics. Symp oma ic analysis can be supplemen ed wi h MRI o assess whe he o no he e is

Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
INTRODUCTION
20
b ain a ophy, o i can be u he aided by o he imaging s udies such as posi on emission omog aphy
(PET) and SPECT. PET is used o assess biochemical p ocesses; hus, bo h PET and SPECT a e used o
e alua e he in eg i y o he nig os ia al dopamine gic pa hways o check whe he o no dopamine
anspo e up ake is being educed in he b ain. Since in DLB i has been iden i ied ha occipi al
hypome abolism exis s, PET can also be used o assess possible b ain me abolism impai men s using F-
luo odeoxyglucose (FDG), a adiopha maceu ical speci ic o glucose anspo and me abolism. To da e,
he e a e s ill no labo a o y es s ha help diagnose DLB because no pa icula ma ke has ye been ound
o his disease [20], [24], [26]–[28].
Some medica ions, such as Le odopa a e used o elie e he symp oms o DLB, bu he e is s ill
no ea men ha can s op disease p og ession [3], [20].
E en hough his disease is he second mos common o m o neu odegene a i e demen ia, i is
o en misdiagnosed, unde - esea ched, unde - ecognized, and unde ea ed [29].
c)
Mul iple Sys em A ophy
Mul iple sys em a ophy (MSA) is a a e, poo ly cha ac e ized, a al neu odegene a i e disease
wi h an incidence a e o 3 cases
pe
100,000 pe son-yea s o e he age o 50 [20]. This α -
synucleinopa hy is highly p og essi e and a ec s mul iple neu ological sys ems including cogni i e,
au onomic, ce ebella and mo o sys ems. Thus, his disease p esen s a wide ange o symp oms,
including espi a o y ailu e, u ogeni al diso de , u ina y incon inence, cons ipa ion, e ec ile dys unc ion,
o hos a ic hypo ension, espi a o y s ido , swea gland dys unc ion, and mo o p oblems simila o PD
[3], [20], [30]–[32].
As wi h he o he wo α-synucleinopa hies, he diagnosis is made using symp oma ic es s. The
use o MRI is help ul o see whe he o no ce ain a eas o he b ain ha e cha ac e is ic a ophies o MSA.
Pa ien s wi h MSA a e shown o ha e egional hypome abolism in he
s ia um
, b ains em, and
ce ebellum, so pe o ming an FDG-PET may help in he diagnosis. In con as o DLB and PD, he use o
p esynap ic dopamine PET o SPECT imaging is no e y help ul. The use o labo a o y es s o con i m
his disease does no ye exis [20].
Despi e he exis ence o some ea men s o alle ia e bo he some symp oms, no e ec i e he apy
o MSA exis s because he mechanism o disease p og ession is unknown [3], [20].
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
INTRODUCTION
21
O he h ee α-synucleinopa hies men ioned, he i s wo a e he mos p oblema ic, gi en hei
s a is ical alues. Howe e , o none o he h ee, he e is an ea ly diagnosis o any ype o ea men ha
allows he cu e o p e en s disease p og ession. In his way, gi en ha AS agg ega ion is a pa hological
hallma k o all hese neu odegene a i e diseases, he ocus on de eloping s a egies ha a ge his
p o ein agg ega es may ha e a p omising u u e as po en ial diagnos ic/ he apeu ic app oach.
1.2. α-Synuclein
α-synuclein (AS) is a p o ein ha belongs o a small amily o he h ee synuclein p o eins: α-
synuclein, β-synuclein and γ-synuclein. I is composed o 140 amino acids encoded by he synuclein
alpha gene (SNCA) localized on ch omosome 4q21-q23, and p esen s a high solubili y, which allows i o
be easily inco po a ed in o cell memb anes. I is cha ac e ized as a na i ely un olded s uc u e and
sc eens wo di e en s uc u al con o ma ions: a diso de ed monome o an α-helical mul ime ic shape
(Figu e 1). The monome s may i s associa e in o oligome ic species ( oxic o ms) ha subsequen ly
p og ess o ib illa agg ega ed o ms (wi h β-shee con o ma ion), culmina ing in ib illa amyloid o ms,
which a e p esen in Lewy bodies. Thus, he mis olding and consequen ly agg ega ion o he monome s
is a key ac o in he o ma ion and p og ession o he neu odegene a i e diseases known as α-
synucleinopa hies [21], [33].
Figu e 1. The α-synuclein agg ega ion p ocess (adap ed om [21]). C ea ed in BioRende .com.
In addi ion, his p o ein con ains h ee dis inc s uc u al domains (Figu e 2A). The N- e minal
domain ( esidues 1–60), which is o e all posi i ely cha ged, has a high con en o hyd ophobic amino
acids. I is an amphipa hic lysine- ich egion cha ac e ized by epe i ions o he six lysine- ich highly
Memb ane-bound
helically olded
monome
Un olded
monome
↔
Oligome
Fib ils
Lewy body
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
INTRODUCTION
22
conse ed mo i s KTK(E/Q)GV, ha play an impo an ole in lipid binding and α-helix o ma ion. This
in e ac ion o AS wi h memb ane lipids is becoming an inc easingly a ac i e a ea o unde s anding he
mechanisms o AS agg ega ion, as lipids a e being iden i ied as elemen s wi h a high p eponde ance in
enhancing AS agg ega ion. The AS-lipid in e ac ion can lead o he p ima y nuclea ion, which leads o he
o ma ion o oxic o ms o AS - he oligome s, which consequen ly lead o he o ma ion o ib illa AS
(Figu e 2B) [13], [34]–[36]. Mo eo e , ha egion, essen ial be ween esidues 45-54, has pa icula
impo ance since i is in his domain whe e a e localized all known clinical mu a ions ha a e associa ed
wi h he cases o DLB and PD; he e o e, hese mu a ions a e an impo an elemen o p omo e and
inc ease agg ega ion o α-synuclein. The cen al hyd ophobic egion ha is ich in hyd ophobic mo i s
comp ises he non-amyloid-componen (NAC) ( esidues 61–95) and esidues 71–82 (VTGVTAVAQKTV),
c ucial o AS agg ega ion (mainly i s ib illa ion). Las ly, he C- e minal egion ( esidues 96–140), a
nega i ely cha ged egion, is highly acidic and p oline en iched and is in ol ed in he p o ein’s chape one-
like ac i i y [8], [21], [37]–[40].
Figu e 2. α-synuclein s uc u e and agg ega ion p ocess. [A] Na i e sequence o α-synuclein: clinical mu a ions (Ala30P o,
Glu46Lys, His50Gln, Gly51Asp, Ala53Th , Ala53Val, and Ala53Glu) ma ked in highligh ed o ange; he amphipa hic N- e minal
egion con ains six impe ec lysine- ich highly conse ed mo i epea s, ma ked in pu ple; he cen al hyd ophobic egion is
unde lined and he hyd ophobic egion is ma ked in yellow; he wo majo phospho yla ion si es (Se 87 and Se 129) a e
colou ed in pink, he chape one-media ed au ophagy ecogni ion si es a e ma ked in da k blue, and ni a ion si es (Ty 39,
Ty 125, Ty 133, and Ty 136) a e shown in ligh blue (adap ed om [21]); [B] The α-synuclein agg ega ion media ed by he
in e ac ion α-synuclein-lipid [34].
AS is p edominan ly loca ed a he p esynap ic e minals o neu ons, and al hough i s unc ion in
he body is no ye ully unde s ood, i is belie ed o be in ol ed in egula ing synap ic esicle a icking
in he heal hy b ain ia di ec in e ac ion wi h lipid memb anes. This unc ion is essen ial o assembling
he N-e hylmaleimide-sensi i e ac o a achmen p o ein ecep o (SNARE) complexes because hese a e
c ucial o eleasing neu o ansmi e s a p esynap ic ne e e minals, o ins ance, dopamine (which
plays a ele an ole in mo i a ion, a en ion, egula ing body mo emen s, memo y, and cogni i e
[A]
M1DVFMKGLSKAKEGVVAAAEKTKQGVAEAA30GKTKEG
VLYVGSKTK45EGVVHGV52AT54V55AEKTK60EQVTNV
GGAVV71TGVTAVAQKTV82EGAGSIAAATGFV95KKDQLG
KNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE
A140
[B]
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
INTRODUCTION
23
unc ions). This highligh s he ac ha AS is a p eponde an ac o in neu odegene a ion [8], [21], [41],
[38].
The mis olding and agg ega ion
in i o
o AS is condi ioned by se e al condi ions such as
inc eased empe a u e; lipids wi h high solubili y in aqueous solu ion and sho hyd oca bon chains;
molecula c owding; acidic pH; hepa in; di alen and i alen me al ions such as aluminum, coppe (II),
i on (III), cobal (III) and manganese (II); o ganic sol en s; and o he glycosaminoglycans, polyca ions,
pes icides and α-synuclein binding p o eins. Fu he mo e, missense mu a ions (changing a nucleo ide
gi es ise o a codon ha encodes a di e en amino acid) and pos - ansla ional modi ica ions o AS, like
phospho yla ion, ubiqui ina ion, ni a ion, sumoyla ion, unca ion, and N– e minal ace yla ion, a e
b oadly implica ed in he p ocess o α-synuclein agg ega ion and neu o oxici y. This occu s because he
accumula ion o he AS agg ega es in p esynap ic e minals o he axons u n he cells mo e sensi i e o
a a ie y o oxic inju ies [8], [38], [42]. The mos o dina y pos - ansla ional modi ica ion is
phospho yla ion, as abou 90% o he AS agg ega es in Lewy bodies a e phospho yla ed on he se ine
esidue-129 (p-S129). The ubiqui ina ion in lysine esidues (mainly a K6, K10, and K12 esidues) and
he ni a ion in y osine (Y39, Y125, Y133, and Y136), a e he o he wo mos common pos - ansla ional
modi ica ions [8], [38].
In his way, i is no o ious ha AS has a undamen al ole in he de elopmen o α-
synucleinopa hies.
1.3. Blood-B ain Ba ie
He eupon, i is c ucial o c ea e s a egies o ea men and/o diagnosis o α-synucleinopa hies.
Howe e , he anspo o mos he apeu ic molecules o he b ain is blocked by he exis ence o a
physical, me abolic, anspo and immunological ba ie , which main ains homeos asis be ween he
blood and he b ain. This na u al ba ie , which p o ec s he cen al ne ous sys em (CNS), is called blood-
b ain ba ie (BBB) and ep esen s a signi ican challenge o de eloping app oaches o ea men and/o
diagnosis o neu ological diseases. BBB is a highly selec i e semipe meable ba ie ha con ols he in lux
and e lux o di e en subs ances. This ba ie only enables a speci ic exchange o nu ien s, ions,
me abolic was e p oduc s, mine als and signaling molecules be ween he blood and he b ain. I also has
he aim o p o ec ing he b ain om physiological luc ua ions o he plasma and om blood-bo ne
compounds ha may in e pose wi h he no mal neu o ansmission p ocess.
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
INTRODUCTION
30
This in oduc ion o unc ional de i a i es in he coa p o eins allows su ace modi ica ion o he
phages wi h a ious chemicals such as ch omopho es, luo escen dyes, enzymes, and syn he ic
oligome s, playing an essen ial ole in a panoply o applica ions such as bioimaging, issue enginee ing
and biosenso s [67].
c)
M13 Phage Applica ions
Biosa e y, mass manu ac u ing wi h uni o m pa ame e s a a low cos , and all he in o ma ion
p esen ed he e show why his phage o e s po en ial o nume ous applica ions in di e en a eas [80].
As al eady men ioned, phages and Phage Display ha e been used o clinical usage. Mu gas
e
al
. demons a ed ha M13 phages ha e a high po en ial as an immuno he apeu ic s a egy o colo ec al
cance (CRC). This cance is qui e le hal, and cu en ly, he e a e no e ec i e con en ional ea men s.
Thus, since his pa hology is cha ac e ized by high exp ession o he ca cinoemb yonic an igen (CEA) ha
p omo es he agg a a ion o his umo 's magni ude, his was he main a ge . This g oup o esea che s,
h ough a sys emic adminis a ion o CEA-speci ic M13 phages (M13 phages ha exhibi ed in he p3
p o ein o i s capsid, single-chain a iable agmen s (scF ) de i ed om a monoclonal an ibody speci ic
o CEA), in mice wi h CRC showed a ma ked educ ion in he g ow h o his umo [81]. Mo e ecen ly,
Han
e al
. designed a new pu pose agains his umo al ac i i y, whe ein he majo coa p o ein, p8, o
he M13 phage displayed an an i umo cy okine, g anulocy e-mac ophage colony-s imula ing ac o (GM-
CSF), which signi ican ly dec eases umo g ow h in mu ine. Fu he mo e, his app oach combined wi h
adia ion imp o ed he pe o mance o his he apy [82].
In he cu en days, wi h he con inuous inc ease o d ugs esis ance, phage he apy can be a
new solu ion, as Lu & Collins showed. Thei s udy demons a ed ha ans e ing genes ha dec ease
he SOS esponse o bac e ia o he dys unc ions caused by an ibio ics ia he M13 phage weakened he
bac e ia making hem mo e suscep ible o an ibio ics [83].
Filamen ous phages can also be used as biosenso s, which is help ul o isualizing he
p og ession o diseases in such a way ha ele an in o ma ion can be ob ained o diagnosis and
ea men . This is possible, as he phage capsid con ains unc ional g oups wi h a ying eac i i y, whe e
mul iple syn he ic molecules can be selec i ely bound o he phage sca old. These phages a e mainly
p esen ed as a nanop obe by conjuga ing luo escen molecules and a ge ing moie ies on he capsid
su ace. Li
e al
. o example, enginee ed a dual-modi ied M13 pa icles able o de ec human KB umo
cells by emi ing luo escence upon binding o olic acid (FA) o he umo cells. The FA is a i amin ha
plays an impo an ole a he cellula le el, and i is aken up by he ola e ecep o (FR) p esen in cells

Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
INTRODUCTION
31
and o e exp essed in cance . The dual-modi ica ion on he phage consis ed o chemical modi ica ions o
he subuni s o he p8 p o ein, which allowed he binding o he olic acid and luo escen molecules [84],
[85]. Gosh
e al
. de eloped M13 phages as a magne ic nanopa icle ehicle o
in i o
p os a e cance
imaging. In hei wo k, he M13 phage genome was modi ied so ha he mino capsid p o ein, p3,
exhibi ed a a ge ing pep ide wi h a ini y o SPARC (Sec e ed, Acidic, Cys eine Rich P o ein), a
glycop o ein highly exp essed in melanoma, agg essi e melanoma, b eas , b ain, p os a e, colon, and
lung cance . The pep ide used is known as SPARC-binding pep ide (SBP). Conce ning he p8 p o ein, i
has been chemically al e ed o house magne ic i on oxide nanopa icles (MNPs). Nanopa icles a e
p omising con as agen s o dynamic molecula imaging due o hei in insic op ical, elec ical and
magne ic p ope ies, so MNPs we e used o de ec speci ic umo s ia da k con as magne ic esonance
imaging. The esul s o his s a egy sugges ed ha he use o M13 compa ed o nanopa icles, ha we e
di ec ly unc ionalized wi h a ge pep ides, was mo e e ec i e o ampli ied a ge ing
in i o
and was
able o ob ain be e da k con as imaging
in i o
, as each SPARC a ge molecule deli e ed a la ge
numbe o nanopa icles o he cells [86]. Mo eo e , Gosh
e al
., in 2012, used he M13 phage as a
p omising pla o m o p os a e umo cell imaging and d ug deli e y. They gene ically manipula ed he
M13 phage so ha he p3 p o ein was used o SPB. In addi ion, he phage was also gene ically and
chemically unc ionalized so ha he d ug doxo ubicin (DOX), commonly used in chemo he apeu ic
sec ions, was coupled o he p8 p o ein subuni s, and also so ha luo escen molecules (s ep a idin
Alexa Fluo ® 488 Alexa) we e p esen ed on he su ace o he p9 p o ein o de ec he p os a e cance
cells. This whole phage complex has been demons a ed
in i o
o be a po en ial moni o ing ool due o
he acqui ed luo escence. Besides ha , his phage app oach was p o ed o ha e he apeu ic po en ial
as i was able o dec ease no only he iabili y o he cance cells bu also educed he concen a ion o
he applied d ug, as i is a a ge ed d ug deli e y [87], [88].
Liposomes a e a i icial phospholipid esicles cha ac e ized by easy deg ada ion, li le o no side
e ec s, high loading capaci y and good biocompa ibili y, making hem sui able d ug ca ie s. Howe e ,
his ype o d ug deli e y is no s able in he biological sys em, so Ngweni o m
e al
. de eloped a phage
M13-liposome complex o op imize he pe o mance o hese nanomolecules. Th ough elec os a ic
in e ac ions, igge ed by he nega i ely cha ged pep ide displayed on he majo i y p o ein o he p o ein
coa , he liposomes we e coupled o he phage. Inside, he liposomes we e loaded wi h zinc
ph halocyanine (ZnPc), a d ug es ed as a pho osensi ize o pho odynamic he apy (PDT). This
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
INTRODUCTION
32
nanos uc u e has been shown o ha e he po en ial o be used o a ge ed d ug deli e y in PDT and o
eaching speci ic cells [89], [90].
Those wo ks showed di e en examples whe e he M13 ilamen ous phage is used as a pla o m.
Thus, his phage can be applied as an inno a i e s a egy o diagnose/ ea α-synucleinopa hies.
Being his pu pose powe ed by he wo ks o Hemi Diman and hei colleague, ha desc ibed he
na u al capaci y o phage M13 o disagg ega e α-synuclein agg ega es
in i o
. They obse ed ha when
his phage is incuba ed wi h an α-synuclein ib il solu ion, ib il disagg ega ion occu ed h ough a possible
in e ac ion o he ilamen ous phages o a hyd ophobic s e ch in he cen al hyd ophobic egion spanning
amino acids 73–85 [37], [91]–[93]. This abili y is an exci ing and ele an skill o his wo k.
1.5. Pep ide Ta ge ing
Di ec ly a ge ing he agg ega ion p ocess is an appealing he apeu ic s a egy. Hence, he
in e es in using pep ides in his a ea, especially when i comes o neu odegene a i e esea ch, has been
g owing. This happens because pep ides ha e a high po en ial o p e en ib illa o ma ion, as hey a e
able o block he su ace p o ein-p o ein in e ac ions o med du ing he agg ega ion p ocess, which is no
achie ed by mos o he small molecules ha cons i u e he comme cial d ugs. Mo eo e , pep ides ha e
a highe speci ici y o a ge ing, which leads o a educ ion in undesi able side e ec s [94]. In 2015,
Che u a a
e al
. designed a mul iplexed in acellula p o ein- agmen complemen a ion assay (PCA)
lib a y sc eening sys em based on he na i e AS sequence 45-54, which is desc ibed as he egion o AS
ha con ains missense mu a ions implica ed in he agg ega ion p ocess. Using his sequence as a
empla e, hey c ea ed a 209,952-membe pep ide lib a y wi h en amino acids in leng h ha spans
esidues 45–54 (KEGVVHGVAT). F om his lib a y, he pep ide 4554W (K1DGIVN6GVKA) has been
iden i ied as a po en ial candida e ha showed in
in i o
assays educed AS ib il o ma ion and
cy o oxici y [95].
Recen ly, To pey and hei colleagues, based on he wo k o Che u a a
e al
., epo ed ha
4554W pep ide can bind o pa ially o wholly agg ega ed AS species, p e en ing u he ib illa ion and
disagg ega ing p e- o med AS ib ils esul ing in sho e ib ils. Addi ionally, hey did no obse e any
associa ion o he pep ide wi h monome ic AS, which means ha he 4554W pep ide ((KDGIVNGVKA))
does no in e e e wi h he na i e unc ion o AS [94]. Then, Meade
e al
. s udied he ole o he in e ac ion
be ween AS-lipid in he p ima y nuclea ion since p ima y nuclea ion is he i s s ep o agg ega ion. Thei
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
INTRODUCTION
33
expe imen used 1,2-dimy is oyl-sn-glyce ol-3-phospho-L-se ine (DMPS) esicles as a phospholipid model,
since hey a e an impo an elemen in dopamine gic synap ic esicles, which lead o AS memb ane
binding, and consequen ly an inc ease o local concen a ion o AS ha accele a es p ima y nuclea ion.
The esul s indica ed ha 4554W inhibi s lipid-induced p ima y nuclea ion o AS
in i o
. The e o e, he
4554W has a c ucial ole in he p ima y nuclea ion, which is impo an because he p ima y nuclea ion
is conside ed a c i ical s ep o he neu o oxici y associa ed wi h AS and a desi ed poin o inhibi o
unc ion [96]. Mo e ecen ly, Meade
e al
. published a wo k whe e hey op imized he pep ide 4554W.
They pe o med a comple e alanine scan analysis (each esidue o 4554W pep ide was eplaced o an
alanine). Indeed, hey e i ied ha he subs i u ion N6A co esponding o he pep ide 4554WN6A
(K1DGIVA6GVKA) exhibi ed a signi ican inc ease in pep ide e icacy in inhibi ing lipid-induced p ima y
nuclea ion, which sugges s ha he o he esidues o he o iginal pep ide ha e an impo an unc ion in
he inhibi o y e ec o he agg ega ion pa hway. In ending o educe he size o he 4554WN6A pep ide
o he smalles unc ional uni equi ed in he ac i i y, hey ound ha unca ion a he N- e minus o he
pep ide, which esul ed in he dele ion o he K amino acid om posi ion 1, ga e ise o he 4654WN6A
pep ide (DGIVA6GVKA). This new pep ide e idenced a signi ican inc ease in educing he numbe o oxic
oligome ic species in lipid memb anes, blocking AS agg ega ion and associa ed cy o oxici y
in i o
, which
means ha he K esidue is indispensable. This s udy also e idenced ha pep ides 4554W, 4554WN6A
and 4654WN6A, being an agonis s o AS agg ega ion and associa ed oxici y, do no di ec ly p e en he
binding o AS o lipids, which is a desi able ac o since he associa ion o AS o small synap ic
neu o ansmi e esicles should no be dis up ed, so no o in e e e wi h he no mal ac i i y o he
dopamine gic esicle usion and ecycling p ocess [34].
In May o his yea , Meade and colleagues used PCA me hodology o sc een he 45-54 pep ide
lib a y, bu his ime agains i e o he cha ac e is ic clinical mu a ions in his 45-54 egion (A30P, E46K,
H50Q, G51D, and A53T), wi h he goal o iden i ying a pep ide ha would be e ec i e no only agains
he amilial AS a ian om which i was selec ed, bu also agains wild- ype (WT) AS. The sc eening
iden i ied i e pep ides: A30PW (EEGVIDGIAA), E46KW (KEGVVNVVKA), H50QW (ENGVVNGVAT), G51DW
(EDGVVDGVDA), and A53TW (EDAVVNGVAA), all o which had common esidues a some places bu
di e ed a o he s. All educed agg ega ion o he ele an a ge , and some we e shown o educe
agg ega ion when incuba ed wi h o he a ian s. The G51DW pep ide demons a ed he be e ac i i y
among hese pep ides. In addi ion o he new pep ides iden i ied, he p e iously op imized pep ide,
4554WN6A, was e-pe o med in his s udy, concluding ha i is no only highly e ec i e agains WT AS
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
INTRODUCTION
34
bu also agains se e al mu an o ms. In he cell oxici y s udies, howe e , whe e 4554WN6A excelled in
eco e ing oxici y, G51DW had he e e se impac and appea ed o inc ease oxici y o some AS a ian s.
This highligh s he p omising na u e o pep ide 4554WN6A o diagnos ic and he apeu ic applica ions
[97].
Based on all he a o emen ioned, i can be in e ed ha he cons uc ion o a phage pa icle
exp essing pep ide ligands capable o iden i ying AS agg ega es pa es he way o de eloping a no el
app oach o ea ly diagnosis, p e en ion, and/o ea men o α-synucleinopa hies.
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
MOTIVATION AND OBJECTIVES
35
2. MOTIVATION AND OBJECTIVES
α-synucleinopa hies a ec millions o people wo ldwide. The de elopmen o new s a egies o
diagnosis and/o ea men o hese neu odegene a i e diseases is u gen o p e en i s onse and
possibly hal /inhibi disease p og ession. Achie ing his ea will be an amoun o e u ning people wi h
hese diseases o no mal li es. Howe e , he p og ess o new app oaches is limi ed by he BBB ha
houses he CNS, and cu en ly, he e is no e ec i e app oach de eloped o ea ly diagnose no ea α-
synucleinopa hies.
The e o e, he p esen p oposal aims o de elop a phage-based sys em capable o de ec ing he
α-synuclein agg ega es by shu ling α-synuclein speci ic pep ides ac oss he BBB able o ecognize and
bind α-synuclein agg ega es in he b ain.
He eupon, his p ojec in ol es h ee main objec i es: i) he de elopmen o a phagemid
con aining he DNA sequence o α-synuclein speci ic pep ides, wi h high binding po en ial o α-synuclein
agg ega es; ii) he de elopmen o enginee ed phages con aining he pep ide(s) o in e es ; and iii)
cha ac e iza ion assays incuba ing he enginee ed phages wi h α-synuclein o assess hei binding
capaci y o he 45-54 egion o α-synuclein, and check he mo phology ha phages and p o ein adop
when hey bind.

Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
MATERIAL AND METHODS
36
3. MATERIAL AND METHODS
This p ojec includes h ee main asks: syn hesis o he phagemids con aining he pep ides o
in e es , enginee ed M13 phage p oduc ion, and cha ac e iza ion assays.
3.1. De elopmen o phagemids
This ask in ol es de eloping h ee phagemids con aining he DNA sequence o α-synuclein
speci ic pep ides (4554: KEGVVHGVAT, 4554W: KDGIVNGVKA, and 4554WN6A: KDGIVAGVKA). The
pep ides 4554W and 4554WN6A ha e been epo ed in he li e a u e o ha e high po en ial a ini y o α-
synuclein. These pep ides we e gene a ed based on he sequence o he 45-54 AS egion. Howe e , hey
di e om he na i e sequence. Thus, in o de o ha e a pep ide ha unc ions as a con ol in ela ion o
he o he wo, he 4554 pep ide was designed in his wo k. The sequence o 4554 pep ide co esponding
o he na i e egion 45-54 o AS, wi hou any modi ica ion.
3.1.1. Inse syn hesis
In his wo k, h ee pep ides (4554, 4554W, 4554N6A) will be displayed on he su ace o he
M13 phage, namely used o p o ein 3. The i s s ep is he syn hesis o he pep ides o in e es . This
p ocess was based ollowing he Rangel me hod: annealing o wo p ime s wi h 100 % complemen a i y
was pe o med, ollowed by a hea ing and cooling p o ocol, o ob ain he inse s [98]. Fo ha , i was i s
necessa y o design he p ime s ( e e se and o wa d) o each pep ide. The amino acid sequences o
he pep ides o in e es we e con e ed o nucleo ide sequences using he speci ic codons o each amino
acid, o ob ain he p ime s. I should be no ed ha , in addi ion o he sequence o each pep ide o in e es ,
each p ime also includes an enzyme es ic ion si e o a pos e io cloning p ocess. The sequences o
he p ime s a e ep esen ed in Table 1.
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
MATERIAL AND METHODS
37
Table 1. P ime s used o ob ain he sequences o he desi ed pep ides: In blue he es ic ion si e o he SacI enzyme; in
g een he SalI enzyme es ic ion si e and in yellow he pep ides o in e es .
P ime s
Sequence 5’-3’
Base
Pai s
(bp)
Pep ide
Sequence
4554
(Fowa d)
TATATAGAGCTCAAGGAGGGCGTGGTGCACGGCGTGGCCACCCGTCGACTATATA
55
KEGVVHGVAT
4554
(Re e se)
TATATAGTCGACGGGTGGCCACGCCGTGCACCACGCCCTCCTTGAGCTCTATATA
4554W
(Fowa d)
TATATAGAGCTCAAGGACGGCATCGTGAACGGCGTGAAGGCCCGTCGACTATATA
55
KDGIVNGVKA
4554W
(Re e se)
TATATAGTCGACGGGCCTTCACGCCGTTCACGATGCCGTCCTTGAGCTCTATATA
4554WN6A
(Fowa d)
TATATAGAGCTCAAGGACGGCATCGTGGCCGGCGTGAAGGCCCGTCGACTATATA
55
KDGIVAGVKA
4554WN6A
(Re e se)
TATATAGTCGACGGGCCTTCACGCCGGCCACGATGCCGTCCTTGAGCTCTATATA
In his eac ion, he indi idual p ime s o each desi ed inse (p oduced by STAB VIDA, Po ugal)
we e able o anneal, he e o e c ea ing a double-s anded DNA p oduc con aining he inse o he speci ic
sequence.
All p ime s we e esuspended in nuclease- ee wa e o a inal concen a ion o 100 µM. The
annealing p ocess was pe o med by adding equimola amoun s o each p ime (20 µL o each espec i e
p ime a a concen a ion o 10 µM). Then, 10 µL o T is- hyd ochlo ide (HCl) a 10 mM, pH8, was added
o a inal olume o 50 µL. The annealing was ca ied ou ollowing he condi ions desc ibed in Table 2,
in a MyCycle TM The mal Cycle (Bio-Rad Labo a o ies, Inc.). Then, he concen a ion was de e mined
using a NanoD op One Mic o olume UV-Vis Spec opho ome e (The mo Scien i ic) and he inse s we e
s o ed a -20 °C un il usage.
Table 2. Annealing condi ions.
S ep
Tempe a u e (°C)
Time (min)
1
93
3
2
80
20
3
75
20
4
70
20
5
65
20
6
40
60
7
4
∞
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
MATERIAL AND METHODS
38
3.1.2. Cloning p ocess o he inse s in o he phagemid
Once he syn hesis o he inse s is comple ed, he nex ask was he liga ion be ween pep ides
(inse s) and ec o (phagemid pETDue -1 p e iously cloned wi h he gene 3 o M13). This ask comp ises
he s eps depic ed in Figu e 6.
Figu e 6. Schema ic ep esen a ion o he diges ion: liga ion p o ocol (c ea ed wi h Snapgene so wa e).
a)
Diges ion Reac ion
Be o e p oceeding o he cloning p ocess, i was i s necessa y o diges he inse s and he
ec o wi h he es ic ion enzymes, SacI (The mo Scien i ic, Lo 00544923) and SalI (The mo Scien i ic,
Lo 00433634). The ec o used was based in he comme cial plasmid pETDue -1 (Addgene, 71146).
This plasmid has been p e iously manipula ed in o de o con ain pa o a phage genome, in his case,
he gene 3 esponsible o codi ying he M13 phage mino coa p o ein 3 and he signal sequence peIB,
which was p e iously added o p omo ing phage p o ein ansloca ion h ough he bac e ial memb ane
and assembly in phage pa icles (Figu e 7).
Figu e 7. Ge al scheme o he main egions o pETDue -1 phagemid. C ea ed in BioRende .com.
[a] DIGESTION
[b] LIGATION
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
MATERIAL AND METHODS
39
The diges ion o he inse s and ec o is essen ial because i will allow he cloning p ocedu e.
Mo eo e , he enzymes used a e unique cu e s ha o m complemen a y s icky ends in he ec o and
inse s and consequen ly enable he inse o be in oduced immedia ely be o e gene 3.
The ec o DNA used o he diges ion had been isola ed p e iously wi h he ZR BAC DNA Minip ep
ki (ZYMO) ollowing he manu ac u e 's ins uc ions and was s o ed a -20ºC.
The inse s and ec o DNA we e diges ed ollowing he condi ions o Table 3 (no e ha di e en
condi ions we e es ed and ha he op imized condi ion was he one selec ed). Then, he samples we e
incuba ed a 37 °C o 2 hou s, ollowed by a 15 minu es enzyme inac i a ion s ep a 65 °C.
Table 3. Reac ion condi ions o ec o and inse diges ion.
b)
Liga ion
Subsequen ly o he diges ion p ocess, he ollowing s ep was o clone he diges ed inse s in o
he diges ed ec o . In his eac ion, he T4 DNA ligase enzyme was used (NewEngland BioLabs® Inc,
M0202S). This enzyme joins he cohesi e end e minals o double-s anded DNA by ca alyzing he c ea-
ion o a phosphodies e link be ween jux aposed 5' phospha e and 3' hyd oxyl e minals.
The e o e, he liga ion was ca ied ou ollowing he condi ion on Table 4, using a 3:1 inse
mola excess o 20-100 ng ec o a io. Fi s , he eac ion was mixed and incuba ed a 16 °C o e nigh .
Then, he T4 DNA ligase was inac i a ed a 65 °C o 10 minu es. Subsequen ly, he liga ion p oduc was
kep a -20 °C un il bac e ial ans o ma ion. No e ha di e en condi ions we e es ed and ha he
op imized condi ion was he one selec ed.
Vec o
Inse
DNA
1500 ng
1000 ng
SacI
1 µL
SalI
1 µL
10x Fas Diges bu e (The mo
Scien i ic, Lo 00440534)
2 µL
Nuclease ee wa e
Up o 20 µL
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
MATERIAL AND METHODS
46
mas e mix shown in Table 7. Then, he PCR eac ion o he sample was pe o med in MyCycle TM
The mal Cycle (Bio-Rad Labo a o ies, Inc.) acco ding o he condi ions p esen in Table 6. The co ec
leng h o he PCR p oduc was con i med by loading 6 µL o he PCR p oduc in a 2.5 % aga ose gel. A e
gel con i ma ion, he PCR p oduc was cleaned and pu i ied using he DNA Clean & Concen a o TM - 5 ki
(ZYMO) ollowing he manu ac u e 's ins uc ions, and he concen a ion o he DNA was quan i ied in
NanoD op One Mic o olume UV-Vis Spec opho ome e s equipmen (The mo Scien i ic).
Table 7. PCR p o ocol.
Las ly, samples we e p epa ed wi h 500 ng o cleaned PCR p oduc , 3 μl o e e se p ime (#7,
see ANNEX I) a a concen a ion o 10 mM, which ampli ies he egion o in e es o he gene 3, o check
he p esence o pep ide sequences o in e es , and wa e o a inal olume o 10 μL was achie ed. The
samples we e sequenced by Eu o ins.
3.3. Cha ac e iza ion
assays
Once he bac e iophages ha exhibi he pep ides o in e es we e success ully enginee ed: i)
phage 4554 (phage F1) ha displays he KEGVVHGVAT pep ide sequence (co esponding o he na i e
egion), ii) phage 4554W (phage F2) ha displays he KDGIVNGVKA pep ide sequence, and iii) phage
4554WN6A (phage F3) ha displays he KDGIVAGVKA pep ide sequence, all he condi ions we e me
o mo e on o he s ep ha p o ided in o ma ion on he pe o mance o he de eloped phages. To his
end, moni o ed cha ac e iza ion assays we e pe o med, whe e comme cial α-synuclein
(1MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTK45EGVVHGVAT54VAEKTK60), (RayBio ech,
Inc), wi h a molecula weigh o 6.1 kDa con aining he N- e minal amphipa hic domain (Figu e 9), was
incuba ed wi h each o he phages displaying he di e en pep ides. These assays aimed o p o ide
insigh s in o he in e ac ions be ween he di e en pep ides and he a ge , i.e., o in e p e hei abili y o
bind o AS and whe he he pep ides ac ually in e ac wi h he 45-54 egion o AS. Consequen ly, he
Componen s
PCR ube
10 μM Fo wa d P ime (#41/#42/#43)
1 µL
10 μM Re e se P ime (#25)
1 µL
Xpe Fas Mas e Mix (Re : QE15, G isp)
12.5 µL
DNA
100 – 200 ng
H2O ee nuclease
Up o 25 µL

Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
MATERIAL AND METHODS
47
pe o mance o each pep ide exhibi ed by phage M13 was e alua ed and compa ed wi h each o he . In
addi ion, hese assays we e in ended o supply in o ma ion abou he cha ac e is ics o he a i icial
phages p oduced.
Figu e 9. A schema ic ep esen a ion o he I-TASSER p o ocol o p o ein s uc u e [99]–[101].
3.3.1. AS sample
The AS used o he expe imen s was a comme cial p o ein esuspended in 50 µL o a solu ion
o 20 mM T is-HCl + 100 mM NaCl, pH= 7.5 o a inal concen a ion o 1 mg/mL.
3.3.2. Phage samples p epa a ion
Be o e p oceeding wi h he expe imen s, i was necessa y o p epa e aliquo s o each phage a a
concen a ion o 1 x 109 PFU/mL esuspended in he same bu e as ha o he p o ein (20 mM T is-HCl
+ 100 mM NaCl, pH= 7.5). Thus, in 2 mL eppendo ubes, 2 mL o each phage was added om i s
espec i e s ock solu ion s o ed a 4 °C (Table 8). Then, he samples we e cen i uged a 1000 pm o
20 min a 4 °C and he supe na an was ho oughly disca ded. The esul an pelle om each sample
was esuspended in 2 mL o bu e o a concen a ion o 1 x 109 PFU/mL. All samples we e s o ed a 4
°C un il u he use.
α-Synuclein (1-60 egion)
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
MATERIAL AND METHODS
48
Table 8. Phages concen a ions in s ock.
3.3.3. Dynamic ligh sca e ing (DLS) measu emen s
The size dis ibu ion and he Z- po en ial o he phages (M13 (con ol), F1, F2, and F3) and he
phages incuba ed wi h AS a a inal concen a ion o 6.25 µg/mL (M13+AS, F1+AS, F2+AS, and F3+AS)
was measu ed by DLS, using Ze asize Nano ZS (Mal e n Ins umen s) a 25 °C. In an app op ia e cell
DTS0012 o DTS1070, depending on he pa ame e ha is being measu ed, size o Z- po en ial,
espec i ely, 800 µL o he p epa ed sample we e added. The sample was hen placed in he equipmen
and ead in iplica e, being he esul s desc ibed as mean ± s anda d de ia ion. I is wo h no ing ha
he phage samples we e es ed unde ou condi ions: no incuba ion, 5 minu es, 24- and 48-hou s
incuba ion a 36.6 °C. On he o he hand, he samples con aining phage + AS we e only exposed o he
las h ee condi ions. No e ha he selec ed incuba ion empe a u e was 36.6 ºC, as his is he mice's
body empe a u e [102]. The es s we e simula ed wi h his empe a u e wi h a iew o possible u u e
in
i o
es s.
3.3.4. Sodium dodecyl sul a e - polyac ylamide gel elec opho esis (SDS-PAGE)
In o de o asce ain which o he enginee ed phages had a g ea e in e ac ion wi h he p o ein,
he ee p o ein (which did no bind o he phage) in each sample was elu ed and un on an SDS-PAGE
gel.
a)
P epa a ion o he samples
To eco e he p o ein in solu ion, all he samples used in he p e ious p ocedu e we e eused
and subjec ed o a spin down. Then he con en o each sample was ans e ed o new 1.5 mL Eppendo
ubes and 100 µL o Coomassie blue dye (The moScien i ic) was added o each sample. Subsequen ly,
he samples we e o exed igo ously and we e le o incuba e a oom empe a u e. A e 30 minu es o
incuba ion he samples we e cen i uged o 10 minu es a 17000 pm so ha he p o eins p esen in
solu ion and s ained wi h blue would p ecipi a e. The esul ing supe na an was emo ed, and he pelle
was placed o d y a 39 ºC and s o ed a oom empe a u e un il u u e use. All s o ed samples we e
Phage
Pep ide Displayed
S ock Concen a ion (PFU/mL)
M13
------------
3.6 x 1010
F1
4554
2.2 x 1010
F2
4554W
1 x 1010
F3
4554WN6A
7 x 109
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
MATERIAL AND METHODS
49
esuspended in 20 µL o 1 x T is- Glycine- SDS (TGS) bu e (Nzy ech) and le o incuba e o 2 - 3 hou s.
Then only he con en o he samples con aining phage and AS was aspi a ed and ans e ed o he
espec i e Amicon® Ul a 0.5 mL column (Me ck). In o de ha he ee p o ein in solu ion was elu ed,
he samples we e cen i uged o 15 minu es a 13300 pm and he supe na an was collec ed in new
1.5 mL Eppendo ubes.
b)
P epa a ion o he SDS-PAGE (15 % (w/ ) ac ylamide) gel
Be o e beginning he gel p epa a ion, he elec opho esis sys em's glasses we e washed wi h
dis illed wa e , d ied, and cleaned wi h alcohol o ensu e ha all he g ease has been emo ed. Then,
a e assembling he gel suppo , he esol ing gel a 15% ( ha allows he sepa a ion o p o eins based
on hei molecula weigh ) and he s acking gel ( ha aligns all he p o ein samples loaded in he gel, so
ha hey can en e he esol ing gel a he same ime), we e p epa ed acco ding o he speci ica ions
desc ibed in Table 9. B ie ly, he esol ing gel was i s p epa ed and pipe ed immedia ely on o he gel
ca ie . This was sealed by a hin line o dis illed wa e , which was emo ed once he esol ing gel
polyme ized. Following ha , he s acking gel was p epa ed and p omp ly pipe ed on op o he esol ing
gel, ill he uppe limi o he glasses was eached. Finally, he comb was injec ed quickly a e pipe ing
o minimize e en ion and/o bubble o ma ion, and he gel was allowed o polyme ize. I should be
emphasized ha APS (Ammonium Pe sul a e) and TEMED ( e ame hyle hylenediamine) a e polyme izing
agen s, so hey we e he las eagen s o be in oduced when p epa ing he gels.
Table 9. SDS – PAGE.
Reagen s
Resol ing gel (15 %)
S acking gel (6 %)
H2O ee nuclease
2.8 mL
2.9 mL
40 % Ac ylamide/Bis – Ac ylamide
3 mL
0.750 mL
1.5 M T is- HCl, pH= 8.8
2 mL
--------------
0.5 M T is- HCl, pH= 6.8
--------------
1.25 mL
10% SDS
80 µL
50 µL
20 % APS
80 µL
50 µL
To al
8 mL
8 mL
c)
Applica ion o he samples o be loaded on o he gel
The samples p esen in Table 10 we e loaded on o he gel. Howe e , i was i s necessa y o
p epa e he samples o analysis, so o 8 µL o each sample, 2 µL o 5 x SDS- PAGE Sample Loading
Bu e (Nzy ech) was added. Nex , 10 µL o each p epa ed sample was loaded in o he espec i e well o
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
MATERIAL AND METHODS
50
he gel, as well as 5 µL o he PageRule TM Uns ained B oad Range P o ein Ladde (The moScien i ic,
01135959). The elec opho esis was ca ied ou in 1 x TGS bu e , and he powe supply was au oma ed
o 30 minu es a 80 V, un il he samples pass h ough he concen a o gel and a e comple ely in he
sepa a o gel. Subsequen ly, he ol age was inc eased o 120 V o 40 minu es.
Table 10.
Samples loaded on SDS-PAGE gel
Sample
Desc ip ion
1
Reco e ed p o ein om M13 phage sample
2
Elu ed p o ein om sample wi h M13 and AS
3
Reco e ed p o ein om F1 phage sample
4
Elu ed p o ein om sample wi h F1 and AS
5
Only AS P o ein (a a inal concen a ion o 6.25 µg/ mL)
6
Reco e ed p o ein om F2 phage sample
7
Elu ed p o ein om sample wi h F2 and AS
8
Reco e ed p o ein om F3 phage sample
9
Elu ed p o ein om sample wi h F3 and AS
d)
P o ein S aining
- BlueSa e p o ein s ain:
A e he elec opho esis p ocess, he gel was ca e ully emo ed om he elec opho esis sys em
and washed wi h dis illed wa e . I was hen placed in he s aining solu ion, BlueSa e p o ein s ain
(Nzy ech, MB15201), o e nigh . The nex day, he s aining solu ion was disca ded, and he e ealed
bands we e analyzed. Finally, he gel was p ese ed in dis illed wa e .
- Sil e s ain o p o ein gel:
Fo he pu pose o g ea e de ec ion o banding pa e ns o med a e he elec opho esis p ocess
he s aining can be done in sil e ni a e. Sil e s aining p o ides a high deg ee o pep ide co e age while
main aining excellen sensi i i y (in he e y low nanog am ange). B ie ly, he s aining p ocess
sequen ially consis s o p o ein ixa ion, sensi iza ion, washing, sil e imp egna ion and inally image
de elopmen [103], [104].Thus, ollowing he p o ocol o sil e s aining he gel was i s insed in dis illed
wa e . A e 10 minu es, he dis illed wa e was emo ed, and sodium hiosul a e a 0.2 g/L (VWR P olabo
Chemicals, 16I154125) was added o he gel and le in con ac wi h he gel o 1 minu e. Then, he
sodium hiosul a e solu ion was emo ed, and he gel was washed 2 x 20 seconds in dis illed wa e . The
dis illed wa e was emo ed, and he gel was imp egna ed in a sil e ni a e solu ion a 2 g/L (VWR
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
MATERIAL AND METHODS
51
P olabo Chemicals, 13C250013) du ing 30 minu es. Subsequen ly, he sil e ni a e was emo ed, and
he gel was insed wi h dis illed wa e o 10 seconds. The eina e , he dis illed wa e was disca ded and
he de elope solu ion (0.7 mL/ L o maldehyde 37- 38 % w/w s abilized wi h me hanol PA-ACS (Pan eac,
131328.1211), 30 g/ L sodium ca bona e anhyd ous (Pan eac, 4D013888) and 10 mg/ L sodium
hiosulpha e) was added 2 x 3 minu es and he gel was shaken ca e ully un il he desi ed colo was
achie ed. The de elope solu ion was emo ed, and he gel was incuba ed wi h he s op solu ion (50 g/L
T is-Base (Fishe BioReagen sTM, 153464) and 2.5 % ace ic acid glacial (Fishe BioReagen sTM, 1733740)
o 1 minu e. Finally, he p o ocol ended by washing he gel in dis illed wa e and he de eloped bands
we e analyzed.
3.3.5. Scanning T ansmission Elec on Mic oscopy (STEM)
The mo phological analyses o he 8 samples desc ibed in he Table 11 we e pe o med in an
Ul a-high esolu ion Field Emission Gun Scanning Elec on Mic oscopy (FEG-SEM), NOVA 200 Nano SEM,
FEI Company. Be o e analyses, samples we e ins alled in Cu-C g ids (AGAR S160-4), by imme sion in he
solu ion con aining he phages o phages and AS. Then he samples we e analyzed wi h an accele a ion
ol age o 15 kV, using a scanning ansmission elec on de ec o (STEM). The image iles we e examined
and con e ed in o TIF o ma .
Table 11. Samples analyzed in STEM echnique
Sample
Desc ip ion
Condi ions
M13
Sample con aining M13 a 1 x 109 PFU/mL esuspended in 20 mM T is-HCl +
100 mM NaCl, pH= 7.5
Wi hou incuba ion
F1
Sample con aining F1 a 1 x 109 PFU/mL esuspended in 20 mM T is-HCl +
100 mM NaCl, pH= 7.5
F2
Sample con aining F2 a 1 x 109 PFU/mL esuspended in 20 mM T is-HCl +
100 mM NaCl, pH= 7.5
F3
Sample con aining F3 a 1 x 109 PFU/mL esuspended in 20 mM T is-HCl +
100 mM NaCl, pH= 7.5
M13 + AS
Sample con aining M13 a 1 x 109 PFU/mL and AS a 6.25 µg/ mL
esuspended in 20 mM T is-HCl + 100 mM NaCl, pH= 7.5
Wi h 5 minu es o
incuba ion a 36.6 ºC
F1 + AS
Sample con aining F1 a 1 x 109 PFU/mL and AS a 6.25 µg/ mL esuspended
in 20 mM T is-HCl + 100 mM NaCl, pH= 7.5
F2 + AS
Sample con aining F2 a 1 x 109 PFU/mL and AS a 6.25 µg / mL esuspended
in 20 mM T is-HCl + 100 mM NaCl, pH= 7.5
F3 + AS
Sample con aining F3 a 1 x 109 PFU/mL and AS a 6.25 µg / mL esuspended
in 20 mM T is-HCl + 100 mM NaCl, pH= 7.5
3.3.6. A omic Fo ce Mic oscopy (AFM)
AFM was pe o med o cha ac e ize he mo phology and s uc u e o he modi ied phages. In his
expe imen , se en samples we e analyzed (Table 12). Samples we e imaged in noncon ac mode using

Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
MATERIAL AND METHODS
52
a NanoWiza d® 3 BioScience AFM (JPK Ins umen s). The AFM da a we e ob ained unde di e en
condi ions. The samples AS, M13, F2, and F3 we e di ec ly analyzed om he p epa ed esh samples.
Ne e heless, he samples M13+AS, F2+AS, and F3+AS once p epa ed we e analyzed a e 24 hou s o
incuba ion a 36.6 °C. I should also be s essed ha phage F1 was no analyzed due o he ime
limi a ion.
Table 12. Samples analyzed in AFM.
Sample
Desc ip ion
AS
Sample con aining AS a 0.00625 mg/ mL esuspended in 20 mM T is-HCl + 100 mM NaCl,
pH= 7.5
M13
Sample con aining M13 a 1 x 109 PFU/mL esuspended in 20 mM T is-HCl + 100 mM
NaCl, pH= 7.5
F2
Sample con aining F2 a 1 x 109 PFU/mL esuspended in 20 mM T is-HCl + 100 mM NaCl,
pH= 7.5
F3
Sample con aining F3 a 1 x 109 PFU/mL esuspended in 20 mM T is-HCl + 100 mM NaCl,
pH= 7.5
M13 + AS
Sample con aining M13 a 1 x 109 PFU/mL and AS a 6.25 µg/ mL esuspended in 20 mM
T is-HCl + 100 mM NaCl, pH= 7.5
F2 + AS
Sample con aining F2 a 1 x 109 PFU/mL and AS a 6.25 µg / mL esuspended in 20 mM
T is-HCl + 100 mM NaCl, pH= 7.5
F3 + AS
Sample con aining F3 a 1 x 109 PFU/mL and AS a 6.25 µg / mL esuspended in 20 mM
T is-HCl + 100 mM NaCl, pH= 7.5
In sho , a d op o 15 µL om each sample was d op- cas on o a eshly mica discs (TED PELLA,
INC.) in d y condi ions. The excess was emo ed. Following adso p ion o he samples (2 minu es) a
oom empe a u e, he samples we e d ied using a s eam o ni ogen gas. Then, samples we e
immedia ely analyzed by AFM. The images we e subsequen ly acqui ed in apping mode wi h ACTA-SS-
50 p obe (T: 4.0 µm; L: 125 µm; W: 30 µm; 0: 270.7 kHz; k: 22.187 N/m) a a scan a e o 1.0 Hz and
a esolu ion o 512 x 512 pixels. All images we e ob ained a oom empe a u e. The image iles we e
examined using JPK da a p ocessing so wa e and con e ed in o TIF o ma .
3.3.7. S a is ical Analysis
S a is ical analysis and g aphical p esen a ions we e pe o med using G aphPad P ism 8 so wa e
(Ve sion 8.0.1 o Windows, G aphPad So wa e, San Diego, CA, USA). Be o e any s a is ical analysis,
each condi ion was es ed o no mali y wi h he Shapi o-Wilk es . Fo compa ison o one o wo no mally
dis ibu ed samples, - es was pe o med. I non-no mally dis ibu ed, Mann-Whi ney es was used. To
es di e ences be ween mo e han wo no mally dis ibu ed samples, he ANOVA es was applied. In
case o a leas one o he samples is non-no mally dis ibu ed, he K uskal-Wallis es was pe o med. p
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
MATERIAL AND METHODS
53
alues o less han 0.05 indica ed s a is ical signi icance. E o ba s indica e s anda d e o o he mean
(SEM.
4. RESULTS AND DISCUSSION
In his hesis, he main ocus was on he de elopmen o phages ha display a p3, pep ides ha
ecognize AS in cha ac e iza ion expe imen s. To his end, h ee essen ial AS-speci ic phages we e
enginee ed: i) phage F1, which was used as a con ol o p o e he highe e icacy o he o he enginee ed
phages (F2 and F3), ii) phage F2, and iii) phage F3. O no e, he phage M13KE (emp y phage) was also
used as a nega i e con ol in all expe imen s. Thus, we used hese pep ide sequences o gene a e
modi ied phages wi h he abili y o iden i y AS clus e s.
4.1. Inse Syn hesis
To acqui e he h ee inse s (4554, 4554W, and 4554WN6A) ha codi y he pep ides o in e es ,
a 100% complemen a i y echnique was used o anneal wo p ime s, he o wa d and e e se p ime s o
each inse . The inse s ob ained om his PCR eac ion should be an expec ed size a ound 55 bp (see
Table 1). To e i y i he inse syn hesis was success ul, he esul ing PCR p oduc o each inse was
isualized on a 3 % aga ose gel (Figu e 10). O no e, he p edic ed con o ma ional s uc u e o he
pep ides was simula ed using he I-TASSER so wa e and his in o ma ion can be ound in ANNEX II.
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
RESULTS AND DISCUSSION
54
Figu e 10. Inse size con i ma ion (samples we e loaded on a 3 % aga ose gel): [A] Rep esen a ion o GRS Low Range
Ladde ; [B] Resul s o he elec opho esis p ocess o each inse – L) GRS Low Range Ladde , 1) 4554 inse , 2) 4554W
inse , 3) 4554WN6A inse .
Taking in o conside a ion he size o he designed p ime s (Table 1), a band wi h a size o 55
bp should appea . Looking a he h ee gels in he Figu e 10 and compa ing he esul ing bands wi h
he GRS Low Range Ladde , i could be seen ha all inse s showed he expec ed leng h (≈ 55 bp), as
hey exhibi ed a band sligh ly abo e he 50 bp ladde band, which was expec ed. A e his con i ma ion,
he DNA concen a ion o all samples was de e mined using a NanoD op One Mic o olume UV-Vis
Spec opho ome e s (The mo Scien i ic), and he esul s a e shown in Table 13.
Table 13. DNA quan i ica ion o he inse s and pu i y a ios.
Sample
[DNA] ng/µL
Ra io A260/A280
Ra io A260/A230
4554
202.3
1.82
1.10
4554W
177.9
1.81
1.27
4554WN6A
213.1
1.84
1.22
No e: The A260/A280 a io is commonly used o assess he pu i y o DNA o RNA. A260/A280 a ios o pu e DNA should be a ound 1.8 (and o
RNA should be a ound 2). A lowe a io sugges s he p esence o p o eins, phenol, o o he con aminan s ha abso b s ongly a o nea
280 nm. High A260/A280 pu i y a ios may indica e RNA con amina ion in he sample o DNA, indica ing a p oblem wi h he ex ac ion p o ocol.
The A260/A230 is used o measu e he pu i y o nucleic acids. The p esence o o ganic con aminan s such as phenol, ca bohyd a es, chao opic
sal s, and o he a oma ic compounds is indica ed by he A260/A230 a io. Samples wi h A260/A230 a ios less han 1.8 a e hough o con ain a
signi ican amoun o hese con aminan s. The A260/A230 a io in a pu e sample should be a ound 1.8 - 2.2. A high A260/A230 a io could be he
esul o pe o ming a blank measu emen on a di y pedes al o using an ine ec i e blank measu emen solu ion [105], [106].
50
300
100
700
L
2
25
300
100
50
25
700
c)
d)
L
3
25
50
75
300
L
1
700
[A]
[B]
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
RESULTS AND DISCUSSION
55
The esul s showed ha he annealing p ocess occu ed wi h success because we e ob ained an
adequa e DNA concen a ion o he samples. Rela i ely, o obse ance a ios A260/A280, i can be said ha
he pu i y le el o all samples was accep able since he a ios mee a ound he e e ence alue (≈ 1.8).
Howe e , he a ios A260/A230, indica ed he p esence o o ganic con aminan s likely sal s and phenols in
he samples, since he a ios 1.10, 1.27, and 1.22 a e below he 1.8 ≤ A260/A230 ≤ 2.2 (s anda d alues).
This could be due o he base solu ion (T is-HCl pH = 8) used in he annealing p ime s p ocess because,
in i s composi ion, his componen con ains sal s, which can ha e such in e e ence in he a ios A260/A230.
I should be no ed ha al hough he samples p esen ed his con amina ion, i did no ep esen an
obs acle. Thus, he samples we e used in he s eps ha ollowed, he diges ion.
4.2. Phagemid cloning sys em
As s a ed in he opic 1.4.1 he use o he phagemid sys em is e y applied in phage display
sys em because hey o e mo e lexibili y and independence o he phage packaged du ing he
ampli ica ion phase, allowing he inse ion o he en i e pep ide sequence [61]. The e o e, o p oduce he
phage display pa icles o in e es , i s ly was necessa y o conjuga e he DNA o he pep ides o in e es
wi h he phagemid ec o , in his case, he modi ied pETDue -1 plasmid. Display o he pep ides o in e es
in p3 is achie able, bu only i he gene sequence o each inse is inse ed be ween he signal sequence,
pelB, and he ups eam codon o gene 3 [58], [68]. In o de o gi e a be e design o he phagemid
cloning sys em, he SnapGene so wa e (www.snapgene.com) was u ilized o execu e
in silico
cons uc ion
o he plasmid including he inse s o in e es (Figu e 11).
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
RESULTS AND DISCUSSION
62
Looking on he esul s ob ained in he elec opho esis gel, i was possible o obse e ha he
ampli ica ion egion p esen ed a band wi h he expec ed size (≈ 323 bp) since he samples should p esen
a band sligh ly abo e he 300 bp ladde band, which was e i ied. As he samples p esen ed a band wi h
he expec ed size in he gel, each PCR p oduc was cleaned and pu i ied in o de o p epa e a sample o
sequencing in o con i m he co ec nucleo ide sequence on each phage genome. The cleaning was
pe o med using he DNA Clean & Concen a o TM - 5 ki (ZYMO) ollowing he manu ac u e 's ins uc ions.
A e wa ds his cleaning p ocess, he concen a ion o he DNA o each sample was quan i ied in
NanoD op One Mic o olume UV-Vis Spec opho ome e s equipmen (The mo Scien i ic), and he esul s
a e p esen in Table 17.
Table 17. DNA quan i ica ion o he clean PCR p oduc and pu i y a ios.
Samples
[DNA] ng/ µL
Ra io A260/A280
Ra io A260/A230
F1 Phage DNA- clean PCR p oduc
107.7
1.87
2.18
F2 Phage DNA- clean PCR p oduc
93
1.87
2.17
F3 Phage DNA- clean PCR p oduc
64.3
1.85
1.36
The esul s exhibi ed in he able showed ha ex ac ion occu ed wi h he success. Rega ding
he abso bance a io A260/A280 i can be said ha he pu i y le el o all samples was accep able since i is
a ound he e e ence alue, ≈ 1.8. Wi h conce ning he A260/A230 a io, i can be s a ed ha he alues o
25
150
300
400
L
1
2
50
150
300
400
L
2
25
50
150
300
400
L
3
①
Figu e 13. Resul s o he elec opho esis gel o he PCR p oduc s (samples we e loaded on a 2.5 % aga ose gel): ①
Rep esen a ion o GRS Low Range Ladde ; L- GRS Low Range Ladde ; 1- PCR p oduc con aining he ampli ica ion o gene
zone 3 om phage DNA ha ha bou s he sequence o in e es o pep ide 4554; 2- PCR p oduc con aining he ampli ica ion
o gene zone 3 om phage DNA ha ha bou s he sequence o in e es o pep ide 4554W; 3- PCR p oduc con aining he
ampli ica ion o gene zone 3 om phage DNA ha ha bou s he sequence o in e es o pep ide 4554WN6A.

Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
RESULTS AND DISCUSSION
63
he A260/A230 abso bance a io is conside ed accep able o he wo i s samples, as he a ios a e wi hin
he 1.8 ≤ A260/A230 ≤ 2.2 e e ence alues, which means ha he samples a e ee om con amina ion by
o ganic compounds such as sal s and phenols. Ne e heless, he same was no e i ied o he sample
o he clean PCR p oduc , co esponding o he DNA o phage F3. The a io A260/A230 his sample indica ed
he p esence o o ganic con aminan s likely sal s and phenols, since he a io 1.36, is below he s anda d
alues. This may be due o he bu e s used in he ki because hese a e composed o sal s and phenols.
This con amina ion may also ha e esul ed om incomple e e apo a ion o e hanol, which is applied in
one o he s eps o using he ki . In bo h cases, his con amina ion did no ep esen any hu dle o p oceed,
and he e o e all samples we e sen o sequencing.
The sequencing esul s we e analyzed in he SnapGene so wa e (Table 18). Th ough a close
look a he esul s, i was possible o obse e ha he sequence o he pep ide 4554WN6A was ully
inse ed in o he phage genome. Rega ding he sequencing esul s o he DNA o phages F1 and F2
con aining he pep ide sequence 4554 and 4554W, espec i ely, by using he SnapGene so wa e i was
possible o e i y ha he e was no ma ch wi h he sequences o in e es . A de ailed analysis using he
"Align" ool be ween he esul s ob ained and he sequence o in e es allowed o de ec ha he
sequences o in e es om bo h samples we e p esen . None heless, hese did no coincide wi h he
o iginal sequence, as hey p esen ed inse ions. F om he ch oma og am da a o each sample (see
ANNEX V) i was possible o obse e ha he ex a base pai s co esponded o unde ined peaks o o
peaks o e lapping wi h he main peak (con amina ion), which ended up in e e ing wi h he clea eading
o he da a. In iew o all he analysis pe o med, i was ag eed ha he sequences o in e es we e p esen
and ha he ac ha he o iginal sequence o he inse s o in e es was no de ec ed was due o e o s
associa ed wi h he sequencing p ocess. Thus, i was con i med he p esence o he co ec 4554,
4554W, and 4554WN6A pep ide sequences in he espec i e DNA phage sample.
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
RESULTS AND DISCUSSION
64
Table 18. Sequencing esul s o DNA phages. In unde line he egion he sequence o he pep ide o in e es , and in in ed
e ased he addi ional inse ions in nucleo ide sequence o he pep ides o in e es .
Phage
Inse o In e es
Re e se Pep ide
Sequence (5´- 3’)
Nucleo ide Sequence om sequencing
(5’-3’)
F1
4554
GGTGGCCACGCCGTGCAC
CACGCCCTCCTT
…TAATTCTTTCTCACAGTAAGCTCCGTCGTACGG
GTGGG157CCACGCCGTGCACCACGCT176CCTCCTT
CTAATCTAC
F2
4554W
GGCCTTCACGCCGTTCACG
ATGCCGTCCTT
…TCGACGGGCCTTT161CACGCCGTTCACGA A176 T177
TGCCGTCCTTAAATCA
F3
4554WN6A
GGCCTTCACGCCGGCCAC
GATGCCGTCCTT
…GAAGCTTAGTCGACGGGCCTTCACGCCGGCCA
CGATGCCGTCCTTAAACGACTGTCGGCGTGCTTG
…
4.4. Cha ac e iza ion assays
The cha ac e iza ion assays pe o med aimed o de ec whe he enginee ed phages displaying
he pep ides o in e es (4554W and 4554WN6A), conside ed in he li e a u e o be able o in e ac wi h
AS in he 45-54 egion, we e indeed able o ecognize AS [34], [94]–[97]. Fu he mo e, hese assays
we e in ended o mo phologically cha ac e ize he syn he ic phages p oduced.
4.4.1. Physicochemical cha ac e iza ion o he phages pa icles and phages
pa icles incuba ed wi h AS
Fo a phage concen a ion o 1 x 109 PFU/mL and an AS concen a ion o 6.25 µg/mL, phage
pa icles (M13, F1, F2, and F3) and phage pa icles incuba ed wi h AS (M13+AS, F1+AS, F2+AS, and
F3+AS) we e cha ac e ized a he le el o hei size dis ibu ion (Z-a e age) and Ze a po en ial unde
di e en condi ions. The esul s om his i s es , using he Ze asize Nano ZS equipmen , a e illus a ed
in Figu e 14 and Figu e 15.
Acco ding o he esul s p esen in he Figu e 14, i was possible o obse e ha phages wi hou
incuba ion, wi h he excep ion o phage F1(≈ 446,43 nm), p esen ed he expec ed size since he size
dis ibu ion ob ained o phage was in line wi h he li e a u e o phage M13 (≈ 800 - 1000 nm) [58],
[68]. Besides, phages F2 (≈ 805.07 nm) and F3 (≈ 811.65 nm), which display pep ides 4554W and
4554WN6A, espec i ely, showed a la ge size compa ed o phage M13 (790 nm), which also was
expec ed. Only phage F1 p esen ed a smalle size han expec ed. As al eady poin ed ou phages F1, F2
and F3 displayed pep ides a he p3 p o ein end. Howe e , i should be ema kably no ed, ha he
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
RESULTS AND DISCUSSION
65
pep ides o phages F2 and F3 (4554W: KDGIVN6GVKA and 4554WN6A: KDGIVA6GVKA, espec i ely) a e
qui e simila o each o he di e ing only in he amino acid a posi ion 6, whe eas he pep ide o phage F1
p esen s an amino acid sequence wi h mo e dissimila i ies (KEGVVHGVAT). This pa icula i y highligh ed
he e can jus i y he size p esen ed by phage F1. In o he wo ds, pep ide 4554 may be in e e ing wi h he
o e all phage a chi ec u e, hence he phage is smalle in size.
Conside ing he da a o samples incuba ed o 5 min a 36.6°C (condi ion 1) i was possible o
obse e ha he e we e no signi ican changes be ween he non-incuba ed and incuba ed phage
condi ions. Fu he mo e, when compa ing samples con aining only phage wi h samples con aining bo h
phage and AS, i was no able ha he e was no subs an ial change in he size o phages when incuba ed
wi h AS. A e 24 hou s o incuba ion (condi ion 2), a dec ease in he size dis ibu ion o he samples
con aining only phage was no iceable, whe eas he samples con aining bo h phage and AS, wi h he
excep ion o sample M13+AS, showed no size luc ua ions ela i e o he 1 condi ion. Finally, i was
e i ied ha he samples, excluding he sample F3, p ac ically s abilized hei size a e 48 hou s
(condi ion 3). A close look a he se o in e ences d awn om hese da a aises he hypo hesis ha
phages exhibi ing a pep ide in hei p3, ha e es ablished some kind o in e ac ion wi h AS and ha his
in e ac ion does no in luence he physical cha ac e is ics o he phage, as h oughou he incuba ion ime
he phage has conse ed i s size. Ne e heless, o his hypo hesis o be co obo a ed o he ypes o
assays we e ca ied ou .
I should be unde sco ed ha hese alues a e only an es ima e and may no be an app oxima ion
o eali y, since o he measu emen o he sample sizes he phages we e conside ed p o ein ma e ial as
a whole. In addi ion, he equipmen gi es a sphe ical app oxima ion o he size.
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
RESULTS AND DISCUSSION
66
Figu e 14. Cha ac e iza ion o phage pa icles and phage pa icles incuba ed wi h AS p epa ed in 20 mM T is-HCl + 100
mM NaCl, pH= 7.5. The esul s plo ed show means  SD o n= 8 samples. Size dis ibu ion o e ime ( 0: samples wi hou
incuba ion; 1: samples wi h 0.083 h (5 min) o incuba ion a 36.6 °C; 2: samples wi h 24h o incuba ion a 36.6 °C; 2:
samples wi h 48h o incuba ion a 36.6 °C). S a is ical signi icance o he da a was de e mined by - es and wo-way ANOVA
(*p ≤ 0.05 and ****p ≤ 0.0001). S a is ical analysis be ween he samples o each ime poin was e mina ed by wo-way
ANOVA (da a no shown).
Rega ding he Z-po en ial esul s (Figu e 15), hei analysis showed ha nea ly all samples
exhibi ed a uni o m loading pa e n o e ime. In he 0 condi ion (no incuba ion a 36.6ºC), whe e only
he cha ge o he samples wi h isola ed phages was e alua ed, i was isible ha he phages ha displayed
a pep ide a he end o he p3 p o ein (F1, F2, F3) showed a mo e nega i e cha ge han he phage M13
(con ol), which indica es ha he pep ide a ached o he p3 p o ein con e ed a mo e nega i e cha ge
o i s espec i e phage. The pep ides exhibi ed may be al e ing he phage s uc u e, p omo ing a g ea e
exposu e o he nega i e amino acids on he phage su ace, which induces his inc ease in cha ge. In he
emaining condi ions and compa ing he esul s ob ained, i is concluded ha he incuba ion o he phages
wi h p o ein does no in e e e wi h he s abili y o he phage cha ge, and ha ega dless o he incuba ion
ime, he Z-po en ial emained p ac ically unchanged. The sample wi h indi idual phage M13 p esen ed
he g ea es oscilla ions, wi h a signi ican inc ease in cha ge (in absolu e alue) du ing he cou se o
ime. I should be no ed ha i was expec ed ha he phages would show a nega i e cha ge gi en ha
he ou e laye o he phage p o ein shell is mainly occupied by he nega i e N- e minal egion o he p8
p o ein, which is highly ich in acidic amino acid esidues ha in e ac wi h he sol en and endow he
F3 (4554WN6A)
0
200
400
600
800
1000
0 1 2 3
Z-a a age (nm)
Time (h)
M13
M13+AS
F3
F3+AS
F2 (4554W)
0
200
400
600
800
1000
0 1 2 3
Z-a a age (nm)
Time (h)
M13
M13+AS
F2
F2+AS
0 1 2 3
0
50
100
150
200
250
500
1000
1500
Z-a a age (nm)
M13
M13+AS
F1
F1+AS
F2
F2+AS
F3
F3+AS
Time (h)
*****
****
****
****
****
****
Samples:
0 1 2 3
-30
-20
-10
0
Ze a (mV)
M13
M13+AS
F1
F1+AS
F2
F2+AS
F3
F3+AS
Time (h)
****
****
****
** *
***
**** **
*
Samples:
[A]
[B]
F1 (4554)
0
200
400
600
800
1000
0 1 2 3
Z-a a age (nm)
Time (h)
M13
M13+AS
F1
F1+AS
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
RESULTS AND DISCUSSION
67
phage wi h a low isoelec ic poin (IEP) [107], [108]. Paolo
e al
. p o ed ha he cha ge o phage M13
came p edominan ly om he cha ges o esidues cons i u ing he majo i y coa p o ein, p8, and
expe imen ally de e mined ha phage M13 had an IEP o 4.05 ± 0.065 [107]. Thus, since all samples
we e p epa ed in a bu e wi h pH= 7.5 and gi en ha he cha ge o p o eins is ela ed o pH and IEP, i
was expec ed ha he phage-con aining samples would be nega i ely cha ged because pH > IEP [109].
Figu e 15. Cha ac e iza ion o phage pa icles and phage pa icles incuba ed wi h AS p epa ed in 20 mM T is-HCl + 100
mM NaCl, pH= 7.5. The esul s plo ed show means  SD o n= 8 samples. Ze a-po en ial o e ime ( 0: samples wi hou
incuba ion; 1: samples wi h 0.083 h (5 min) o incuba ion a 36.6 °C; 2: samples wi h 24h o incuba ion a 36.6 °C; 2:
samples wi h 48h o incuba ion a 36.6 °C). S a is ical signi icance o he da a was de e mined by - es and wo-way ANOVA
(*p ≤ 0.05, **p ≤ 0.01, ***p≤ 0.001, and ****p ≤ 0.0001). S a is ical analysis be ween he samples o each ime poin was
e mina ed by wo-way ANOVA (da a no shown).
F3 (4554WN6A)
-18
-16
-14
-12
-10
-8
-6
-4
-2
0
0 1 2 3
Ze a (mV)
Time (h)
M13
M13+AS
F3
F3+AS
F2 (4554W)
-18
-16
-14
-12
-10
-8
-6
-4
-2
0 0 1 2 3
Ze a (mV)
Time (h)
M13
M13+AS
F2
F2+AS
F1 (4554)
-20
-18
-16
-14
-12
-10
-8
-6
-4
-2
0 0 1 2 3
Ze a (mV)
Time (h)
M13
M13+AS
F1
F1+AS
0 1 2 3
-30
-20
-10
0
Ze a (mV)
M13
M13+AS
F1
F1+AS
F2
F2+AS
F3
F3+AS
Time (h)
****
****
****
** *
***
**** **
*
Samples:

Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
RESULTS AND DISCUSSION
68
4.4.2. P o ein elec opho esis in e p e a ion
As p e iously men ioned, he esul s om he analysis wi h he Ze asize Nano ZS equipmen a e
no su icien o alida e an in e ac ion be ween he designed phages and he a ge o in e es . To con i m
and e alua e he phage ecogni ion capaci y, he samples used in he p e ious assay we e submi ed o
an SDS-PAGE analysis. This p ocedu e aimed, by means o he in ensi y o he bands ob ained, o e i y
which o he phages showed g ea e binding o AS. Thus, based on he s a ing poin ha all samples
con aining phage and AS had he same concen a ion o p o ein, eco e ing he ee p o ein p esen in
hese samples and loading i in o he gel would esul in esponses. The mo e in ense he AS band (6.1
kDa) o a gi en sample he lowe he binding capaci y be ween he phage and he AS.
Un o una ely, as seen in Figu e 16, he SDS-PAGE p ocess did no occu success ully. No clea ,
well-de ined bands we e obse ed on he gel, ende ing in e p e a ion o he esul s impossible. Al hough
wo s aining me hods we e used, and despi e he ac ha he sil e ni a e s ain was mo e sensi i e and
highligh ed new bands ha we e no isualized in he gel when s ained wi h BlueSa e, he bands we e
mo e smea ed. This made eading he esul s e en mo e di icul . Samples 1, 3, 6 and 8 we e used as
con ol o samples 2, 4, 7 and 9, espec i ely. E en hough he lanes o hese samples showed bands,
hey we e no well de ined. In addi ion, in samples 2, 4, 7 and 9 simila band pa e ns o he espec i e
con ol samples we e isualized, when only bands be ween he 5 kDa and 10 kDa bands co esponding
o he molecula weigh o he AS monome s (6.1 kDa) we e supposed o be obse ed. The p esence o
all hese bands means ha he elu ion o only ee p o ein did no occu success ully. I is no ewo hy ha
he ladde band pa e n was no well de ined and sample 5 (con aining only AS), used as a posi i e con ol
showed a he ain and unde ined bands. In addi ion, his also did no show he 6.1 kDa band, which
was expec ed. This e idence would in alida e any kind o illa ion.
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
RESULTS AND DISCUSSION
69
Figu e 16. SDS-PAGE gel: ① Rep esen a ion o PageRule TM Uns ained B oad Range P o ein Ladde ; [A] Gel s ained wi h
BlueSa e and [B] Gel s ained wi h sil e ni a e (L- PageRule TM Uns ained B oad Range P o ein Ladde ; 1- sample wi h
eco e ed p o ein om M13 phage sample; 2- sample wi h elu ed p o ein om sample wi h M13 and AS; 3- sample wi h
eco e ed p o ein om F1 phage sample; 4- sample wi h elu ed p o ein om sample wi h F1 and AS; 5- sample wi h AS
P o ein om s ock; 6- sample wi h eco e ed p o ein om F2 phage sample; 7- sample wi h elu ed p o ein om sample wi h
F2 and AS; 8- sample wi h eco e ed p o ein om F3 phage sample; 9- sample wi h elu ed p o ein om sample wi h F3 and
AS).
Finally, i emains o be men ioned ha om hese esul s no conclusion abou he binding
capaci y be ween phages and AS was ob ained. Consequen ly, no conclusion abou he pe o mance o
each pep ide was d awn. The absence o esul s can be explained by he insu icien mig a ion ime o
he p o eins in he gel, which caused no de ined bands o be ob ained in he gel, and by he lack o
dena u a ion o he sample p o eins. Be o e being loaded in o he gel, all samples should ha e unde gone
a dena u a ion s ep a 95°C o 5 minu es so ha he samples would show a band on he gel
co esponding o he na i e o m o he p o ein and no also show a ange o bands co esponding o
oligome species, which hen end up in e e ing wi h da a eading. In addi ion o hese wo ac o s, he
columns used o he p o ein elu ion may no be in good p ese a ion condi ions, which may ha e
condi ioned hei pe o mance in he elu ion s ep. In summa y, he SDS-PAGE p ocedu e should be
epea ed again conside ing all he condi ions lis ed he e.
15
①
1
2
3
4
L
5
6
7
8
9
250
20
10
L
15
1
2
3
4
L
5
6
7
8
9
250
20
10
L
[A]
[B]
5
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
RESULTS AND DISCUSSION
70
4.4.3. Cha ac e iza ion o AS-speci ic phages by STEM
In o de ed o ob ain in o ma ion abou he mo phology o he indi idual phages and phages
incuba ed wi h AS, he 8 samples shown in Table 11 we e isualized by STEM, as shown in Figu e 17.
F om he SEM images ob ained, i was no possible o de e mine he phage mo phology and how
i is a ec ed upon incuba ion wi h AS. Consequen ly, no conclusions abou he binding capaci y o he
enginee ed phages could be d awn om his assay.
The low esolu ion p o ided by he equipmen and he exis ence o sal s om he solu ion used
in he p epa a ion o he samples we e p eponde an ac o s ha made i impossible o cap u e de ailed
and clea images. Thus, i was ag eed ha a new echnique wi h highe esolu ion, such as ansmission
elec on mic oscopy (TEM), should be used o analyze he samples a he nanome e scale. Fu he mo e,
o a oid ha he con en o in e es o he sample is masked by sal s, a new bu e , con aining less o no
sal s in i s composi ion, should also be used.
5 minu es o incuba ion a 36.6 °C
F1+AS
1 µm
F2+AS
1 µm
M13+AS- Con ol
1 µm
F3+AS
1 µm
Wi hou incuba ion
F2 (4554W)
1 µm
F1 (4554)
4 µm
F3 (4554WN6A)
1 µm
M13- Con ol
1 µm
Figu e 17. STEM esul s. STEM images o samples wi h phages (M13, F1, F2, and F3) and samples wi h phages
incuba ed wi h AS (M13+AS, F1+AS, F2+AS, and F3+AS), wi h and wi hou a 5 minu es incuba ion a 36,6ºC.
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
RESULTS AND DISCUSSION
71
4.4.4. Cha ac e iza ion o AS-speci ic phages by AFM
Visual cha ac e iza ion o he AS-speci ic phages was also pe o med by AFM. In his assay only
he mo phology and size o phages F2 and F3, which exhibi he pep ides wi h high po en ial o ecognize
AS, 4554W and 4554WN6A, espec i ely, was compa ed wi h he wild- ype phage M13. The AFM images
a e shown in Figu e 18.
Figu e 18. AFM cha ac e iza ion esul s: [A] AFM image o AS sample, [B] AFM images o samples wi h indi idual phages
(M13, F2, and F3) wi hou incuba ion; [C] AFM images o samples wi h phage and AS (M13+AS, F2+AS, and F3+AS) wi h 24
h o incuba ion a 36.6 ºC.
One o he ea u es o phage M13, as al eady men ioned, is ha i is a ype o ilamen ous i us
ha has a long cylind ical shape o abou 800-1000 nm. Looking a he Figu e 18[B] image o he
indi idual phages, i was ound ha phages M13, F2 and F3 p esen ed he expec ed mo phology and
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
REFERENCES
78
[15] U. N. Mase ejian, L. Vinikoo -Imle , A. Dilley (Camb idge, MA, “Es ima ion o he 2020 Global
Popula ion o Pa kinson’s Disease (PD),”
In e na ional Pa kinson and Mo emen Diso de Socie y
- Mee ing Abs ac s
, 2020. h ps://www.mdsabs ac s.o g/abs ac /es ima ion-o - he-2020-
global-popula ion-o -pa kinsons-disease-pd/ (accessed Oc . 18, 2022).
[16] “Launch o WHO’s Pa kinson disease echnical b ie .” h ps://www.who.in /news/i em/14-06-
2022-launch-o -who-s-pa kinson-disease- echnical-b ie (accessed Oc . 25, 2022).
[17] W. A. Rocca, “The bu den o Pa kinson’s disease: a wo ldwide pe spec i e,”
The Lance
Neu ology
, ol. 17, no. 11. Lance Publishing G oup, pp. 928–929, No . 01, 2018. doi:
10.1016/S1474-4422(18)30355-7.
[18] E. Ray Do sey
e al.
, “Global, egional, and na ional bu den o Pa kinson’s disease, 1990–2016:
a sys ema ic analysis o he Global Bu den o Disease S udy 2016,”
Lance Neu ol
, ol. 17, no.
11, pp. 939–953, No . 2018, doi: 10.1016/S1474-4422(18)30295-3.
[19] F. Moisan
e al.
, “Pa kinson disease male- o- emale a ios inc ease wi h age: F ench na ionwide
s udy and me a-analysis,”
J Neu ol Neu osu g Psychia y
, ol. 87, no. 9, pp. 952–957, Sep. 2016,
doi: 10.1136/jnnp-2015-312283.
[20] M. G. E kkinen, M. O. Kim, and M. D. Geschwind, “Clinical neu ology and epidemiology o he
majo neu odegene a i e diseases,”
Cold Sp ing Ha b Pe spec Biol
, ol. 10, no. 4, Ap . 2018,
doi: 10.1101/cshpe spec .a033118.
[21] B. Dehay
e al.
, “Ta ge ing α-synuclein o ea men o Pa kinson’s disease: Mechanis ic and
he apeu ic conside a ions,”
Lance Neu ol
, ol. 14, no. 8, pp. 855–866, 2015, doi:
10.1016/S1474-4422(15)00006-X.
[22] F. J. A, Meije , and B. Go aj, “B ain MRI in Pa kinson’s disease,”
F on ie s in Bioscience
, pp.
360–369, 2014.
[23] C. Muelle , C. Balla d, A. Co be , and D. Aa sland, “The p ognosis o demen ia wi h Lewy bodies,”
Lance Neu ol
, ol. 16, no. 5, pp. 390–398, 2017, doi: 10.1016/S1474-4422(17)30074-1.
[24] “Wha Is Lewy Body Demen ia? Causes, Symp oms, and T ea men s,”
NIH- Na ional Ins i ue on
Aging
. h ps://www.nia.nih.go /heal h/wha -lewy-body-demen ia-causes-symp oms-and-
ea men s (accessed Sep. 25, 2021).
[25] J. R. Phillips, E. Ma a , K. A. E. Ma ens, G. M. Halliday, A. A. Mous a a, and S. J. G. Lewis,
“E alua ing he Sus ained A en ion Response Task o Quan i y Cogni i e Fluc ua ions in Demen ia
Wi h Lewy Bodies,”
J Ge ia Psychia y Neu ol
, ol. 33, no. 6, pp. 333–339, 2020, doi:
10.1177/0891988719882093.
[26] E. Ma a , K. A. Ehgoe z Ma ens, G. M. Halliday, and S. J. G. Lewis, “Clinical ea u es o Lewy
body demen ia: insigh s in o diagnosis and pa hophysiology,”
J Neu ol
, ol. 267, no. 2, pp. 380–
389, 2020, doi: 10.1007/s00415-019-09583-8.
[27] D. B. Hogan
e al.
, “The p e alence and incidence o demen ia wi h lewy bodies: A sys ema ic
e iew,”
Canadian Jou nal o Neu ological Sciences
, ol. 43, no. S1. Camb idge Uni e si y P ess,
pp. S83–S95, Ap . 01, 2016. doi: 10.1017/cjn.2016.2.
[28] L. Tagliabue and A. del Sole, “App op ia e use o posi on emission omog aphy wi h [18F]
luo odeoxyglucose o s aging o oncology pa ien s,”
Eu opean Jou nal o In e nal Medicine
, ol.
25, no. 1. pp. 6–11, Jan. 2014. doi: 10.1016/j.ejim.2013.06.012.

Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
REFERENCES
79
[29] F. D’an onio
e al.
, “Demen ia wi h lewy bodies esea ch conso ia: A global pe spec i e om he
is aa lewy body demen ias p o essional in e es a ea wo king g oup,”
Alzheime ’s and Demen ia:
Diagnosis, Assessmen and Disease Moni o ing
, ol. 13, no. 1, 2021, doi: 10.1002/dad2.12235.
[30] M. T oš , M. Pe o nik, and Z. Pi ošek, “Co ela ions o Neu opsychological and Me abolic B ain
Changes in Pa kinson’s Disease and O he α-Synucleinopa hies,”
F on ie s in Neu ology
, ol. 10.
F on ie s Media S.A., No . 14, 2019. doi: 10.3389/ neu .2019.01204.
[31] J. J. Mendoza-Velásquez, J. F. Flo es-Vázquez, E. Ba ón-Velázquez, A. L. Sosa-O iz, B. M. W.
Illigens, and T. Siepmann, “Au onomic dys unc ion in α-synucleinopa hies,”
F on Neu ol
, ol. 10,
no. APR, 2019, doi: 10.3389/ neu .2019.00363.
[32] J. Q. T ojanowski and T. Re esz, “P oposed neu opa hological c i e ia o he pos mo em
diagnosis o mul iple sys em a ophy,” in
Neu opa hology and Applied Neu obiology
, 2007, ol.
33, no. 6, pp. 615–620. doi: 10.1111/j.1365-2990.2007.00907.x.
[33] B. A. Hijaz and L. A. Volpicelli-Daley, “Ini ia ion and p opaga ion o α-synuclein agg ega ion in he
ne ous sys em,”
Molecula Neu odegene a ion
, ol. 15, no. 1. BioMed Cen al L d., Ma . 06,
2020. doi: 10.1186/s13024-020-00368-6.
[34] R. M. Meade, K. J. C. Wa , R. J. Williams, and J. M. Mason, “A Downsized and Op imised
In acellula Lib a y-De i ed Pep ide P e en s Alpha-Synuclein P ima y Nuclea ion and Toxici y
Wi hou Impac ing Upon Lipid Binding,”
J Mol Biol
, ol. 433, no. 24, Dec. 2021, doi:
10.1016/j.jmb.2021.167323.
[35] C. Gal agnion
e al.
, “Lipid Dynamics and Phase T ansi ion wi hin α-Synuclein Amyloid Fib ils,”
Jou nal o Physical Chemis y Le e s
, ol. 10, no. 24, pp. 7872–7877, Dec. 2019, doi:
10.1021/acs.jpcle .9b03005.
[36] R. S ok and A. Ashkenazi, “Lipids as he key o unde s anding α-synuclein beha iou in Pa kinson
disease,”
Na u e Re iews Molecula Cell Biology
, ol. 21, no. 7. Na u e Resea ch, pp. 357–358,
Jul. 01, 2020. doi: 10.1038/s41580-020-0235-y.
[37] H. Diman and B. Solomon, “Filamen ous Phages Reduce α-Synuclein Oligome iza ion in he
Memb ane F ac ion o SH-SY5Y Cells,” in
Neu odegene a i e Diseases
, Ap . 2010, ol. 7, no. 1–
3, pp. 203–205. doi: 10.1159/000295664.
[38] A. Jan, N. P. Gonçal es, C. B. Vaeg e , P. H. Jensen, and N. Fe ei a, “The p ion‐like sp eading
o alpha‐synuclein in pa kinson’s disease: Upda e on models and hypo heses,”
In J Mol Sci
, ol.
22, no. 15, pp. 1–23, 2021, doi: 10.3390/ijms22158338.
[39] N. Rezaeian, N. Shi anizadeh, S. Mohammadi, M. Nikkhah, and S. S. A ab, “The inhibi o y e ec s
o biomime ically designed pep ides on α-synuclein agg ega ion,”
A ch Biochem Biophys
, ol.
634, pp. 96–106, 2017, doi: 10.1016/j.abb.2017.09.015.
[40] A. D. S ephens
e al.
, “Ex en o N- e minus exposu e o monome ic alpha-synuclein de e mines
i s agg ega ion p opensi y,”
Na Commun
, ol. 11, no. 1, 2020, doi: 10.1038/s41467-020-
16564-3.
[41] H. Diman and B. Solomon, “Filamen ous Phages Reduce α-Synuclein Oligome iza ion in he
Memb ane F ac ion o SH-SY5Y Cells,”
Neu odegene Dis
, ol. 7, no. 1–3, pp. 203–205, 2010,
doi: 10.1159/000295664.
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
REFERENCES
80
[42] H. J. Lee, K. Lee, and H. Im, “α-Synuclein modula es neu i e ou g ow h by in e ac ing wi h
SPTBN1,”
Biochem Biophys Res Commun
, ol. 424, no. 3, pp. 497–502, 2012, doi:
10.1016/j.bb c.2012.06.143.
[43] B. Bakhshinejad, M. Ka imi, and M. Khalaj-Kondo i, “Phage display: De elopmen o nanoca ie s
o a ge ed d ug deli e y o he b ain,”
Neu al Regen Res
, ol. 10, no. 6, pp. 862–865, 2015,
doi: 10.4103/1673-5374.158330.
[44] D. A. Galloway, A. E. M. Phillips, D. R. J. Owen, and C. S. Moo e, “Phagocy osis in he b ain:
Homeos asis and disease,”
F on ie s in Immunology
, ol. 10, no. MAR. F on ie s Media S.A.,
2019. doi: 10.3389/ immu.2019.00790.
[45] F. Two , “An in es iga ion on he na u e o ul a-mic oscopic i uses by Two FW, L.R.C.P. Lond.,
M.R.C.S. (F om he Labo a o ies o he B own Ins i u ion, London),”
Bac e iophage
, ol. 1, no. 3,
pp. 127–129, 2011, doi: 10.4161/bac .1.3.16737.
[46] F. D’He elle, “On an in isible mic obe an agonis ic o dysen e y bacilli . No e by M. F. d’He elle,
p esen ed by M. Roux. Comp es Rendus Academie des Sciences 1917; 165:373–5,”
Bac e iophage
, ol. 1, no. 1, pp. 3–5, 2011, doi: 10.4161/bac .1.1.14941.
[47] G. P. SMITH, “Filamen ous Fusion Phage: No el Exp ession Vec o s Tha Display Cloned An igens
on he Vi ion Su ace,”
Science (1979)
, ol. 228, pp. 1315–1317, 1985, doi:
h p://dx.doi.o g/10.1126/science.4001944.
[48] R. Fa , D. S. Choi, and S. W. Lee, “Phage-based nanoma e ials o biomedical applica ions,”
Ac a
Bioma e
, ol. 10, no. 4, pp. 1741–1750, 2014, doi: 10.1016/j.ac bio.2013.06.037.
[49] P. Molek and T. B a ko ič, “Bac e iophages as Sca olds o Bipa i e Display: Designing Swiss
A my Kni es on a Nanoscale,”
Bioconjug Chem
, ol. 26, no. 3, pp. 367–378, 2015, doi:
10.1021/acs.bioconjchem.5b00034.
[50] J. Manilo and N. Yo k, “Bac e iophages,” 2012, doi:
10.1002/9780470015902.a0000773.pub3.
[51] B. Bakhshinejad and M. Sadeghizadeh, “Bac e iophages and de elopmen o nanoma e ials o
neu al egene a ion,”
Neu al Regen Res
, ol. 9, no. 22, pp. 1955–1958, 2014, doi:
10.4103/1673-5374.145371.
[52] S. S. Sidhu, B. K. Feld, and G. A. Weiss, “M13 bac e iophage coa p o eins enginee ed o
imp o ed phage display.,”
Me hods Mol Biol
, ol. 352, no. 5, pp. 205–219, 2007, doi:
10.1385/1-59745-187-8:205.
[53] M. Paschke, “Phage display sys ems and hei applica ions,”
Appl Mic obiol Bio echnol
, ol. 70,
no. 1, pp. 2–11, 2006, doi: 10.1007/s00253-005-0270-9.
[54] H. Qi, H. Lu, H. J. Qiu, V. Pe enko, and A. Liu, “Phagemid ec o s o phage display: P ope ies,
cha ac e is ics and cons uc ion,”
J Mol Biol
, ol. 417, no. 3, pp. 129–143, 2012, doi:
10.1016/j.jmb.2012.01.038.
[55] C. Gao, S. Mao, C. H. L. Lo, P. Wi sching, R. A. Le ne , and K. D. Janda, “Making a i icial
an ibodies: A o ma o phage display o combina o ial he e odime ic a ays,”
P oc Na l Acad Sci
U S A
, ol. 96, no. 11, pp. 6025–6030, 1999, doi: 10.1073/pnas.96.11.6025.
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
REFERENCES
81
[56] L. Chas een, J. Ay iss, P. Pa lik, and A. R. M. B adbu y, “Elimina ing helpe phage om phage
display,”
Nucleic Acids Res
, ol. 34, no. 21, Dec. 2006, doi: 10.1093/na /gkl772.
[57] R. J. K om, P. Bha ga a, M. A. Lob i z, and J. J. Collins, “Enginee ed Phagemids o Nonly ic,
Ta ge ed An ibac e ial The apies,”
Nano Le
, ol. 15, no. 7, pp. 4808–4813, 2015, doi:
10.1021/acs.nanole .5b01943.
[58] K. Raja am, V. Ve mee en, K. Some s, V. Some s, and L. Michiels, “Cons uc ion o helpe
plasmid-media ed dual-display phage o au oan ibody sc eening in se um,”
Appl Mic obiol
Bio echnol
, ol. 98, no. 14, pp. 6365–6373, 2014, doi: 10.1007/s00253-014-5713-8.
[59] M. R. Tohidkia, J. Ba a , F. Asadi, and Y. Omidi, “Molecula conside a ions o de elopmen o
phage an ibody lib a ies,”
J D ug Ta ge
, ol. 20, no. 3, pp. 195–208, 2012, doi:
10.3109/1061186X.2011.611517.
[60] P. E. Lund, R. C. Hun , M. M. Go esman, and C. Kimchi-Sa a y, “Pseudo i ions as ehicles o
he deli e y o siRNA,”
Pha m Res
, ol. 27, no. 3, pp. 400–420, 2010, doi: 10.1007/s11095-
009-0012-2.
[61] D. Gagic, M. Ci ic, W. X. Wen, F. Ng, and J. Rakonjac, “Explo ing he sec e omes o mic obes and
mic obial communi ies using ilamen ous phage display,”
F on Mic obiol
, ol. 7, no. APR, pp. 1–
19, 2016, doi: 10.3389/ micb.2016.00429.
[62] L. Chas een, J. Ay iss, P. Pa lik, and A. R. M. B adbu y, “Elimina ing helpe phage om phage
display,”
Nucleic Acids Res
, ol. 34, no. 21, pp. 1–11, 2006, doi: 10.1093/na /gkl772.
[63] J. B iga i
e al.
, “Diagnos ic p obes o Bacillus an h acis spo es selec ed om a landscape phage
lib a y,”
Clin Chem
, ol. 50, no. 10, pp. 1899–1906, 2004, doi:
10.1373/clinchem.2004.038018.
[64] C. Mao, A. Liu, and B. Cao, “Vi us-based chemical and biological sensing,”
Angewand e Chemie
- In e na ional Edi ion
, ol. 48, no. 37, pp. 6790–6810, 2009, doi: 10.1002/anie.200900231.
[65] A. Liu, G. Abbineni, and C. Mao, “Nanocomposi e ilms assembled om gene ically enginee ed
ilamen ous i uses and gold nanopa icles: Nanoa chi ec u e- And humidi y- unable su ace
plasmon esonance spec a,”
Ad anced Ma e ials
, ol. 21, no. 9, pp. 1001–1005, 2009, doi:
10.1002/adma.200800777.
[66] J. Messing, “Phage M13 o he ea men o Alzheime and Pa kinson disease,”
Gene
, ol. 583,
no. 2, pp. 85–89, 2016, doi: 10.1016/j.gene.2016.02.005.
[67] W. J. Chung, D. Y. Lee, and S. Y. Yoo, “Chemical modula ion o m13 bac e iophage and i s
unc ional oppo uni ies o nanomedicine,”
In J Nanomedicine
, ol. 9, no. 1, pp. 5825–5836,
Dec. 2014, doi: 10.2147/IJN.S73883.
[68] G. Å. Løse and I. Sandlie, “Nex gene a ion phage display by use o pVII and pIX as display
sca olds,”
Me hods
, ol. 58, no. 1, pp. 40–46, 2012, doi: 10.1016/j.yme h.2012.07.005.
[69] S. H. Yang, W. J. Chung, S. McFa land, and S. W. Lee, “Assembly o bac e iophage in o unc ional
ma e ials,”
Chemical Reco d
, ol. 13, no. 1, pp. 43–59, 2013, doi: 10.1002/ c .201200012.
[70] S. W. Smeal, M. A. Schmi , R. R. Pe ei a, A. P asad, and J. D. Fisk, “Simula ion o he M13 li e
cycle I: Assembly o a gene ically-s uc u ed de e minis ic chemical kine ic simula ion,”
Vi ology
,
ol. 500, pp. 259–274, Jan. 2017, doi: 10.1016/j. i ol.2016.08.017.
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
REFERENCES
82
[71] B. Bakhshinejad and M. Sadeghizadeh, “Bac e iophages and hei applica ions in he diagnosis
and ea men o hepa i is B i us in ec ion,”
Wo ld J Gas oen e ol
, ol. 20, no. 33, pp. 11671–
11683, Sep. 2014, doi: 10.3748/WJG.V20.I33.11671.
[72] Y. Geo gie a and Z. Kon hu , “Design And Sc eening O M13 phage display cDNA lib a ies,”
Molecules
, ol. 16, no. 2. pp. 1667–1681, Feb. 2011. doi: 10.3390/molecules16021667.
[73] N. J. Benne , D. Gagic, A. J. Su he land-Smi h, and J. Rakonjac, “Cha ac e iza ion o a dual-
unc ion domain ha media es memb ane inse ion and excision o F ilamen ous bac e iophage,”
J Mol Biol
, ol. 411, no. 5, pp. 972–985, Sep. 2011, doi: 10.1016/j.jmb.2011.07.002.
[74] R. J. Dubos, J. H. S aus, and C. Pie ce, “THE MULTIPLICATION OF BACTERIOPHAGE IN VIVO
AND ITS PROTECTIVE EFFECT AGAINST AN EXPERIMENTAL INFECTION WITH SHIGELLA
DYSENTERIAE,”
Jou nal o Expe imen al Medicine
, ol. 3, no. 78, pp. 161–168, 1943, doi:
h ps://doi.o g/10.1084/jem.78.3.161.
[75] D. F enkel and B. Solomon, “Filamen ous phage as ec o -media ed an ibody deli e y o he
b ain.” [Online]. A ailable: www.pnas.o gcgidoi10.1073pnas.072027199
[76] D. F enkel, I. Dewach e , F. an Leu en, and B. Solomon, “Reduc ion o β-amyloid plaques in
b ain o ansgenic mouse model o Alzheime ’s disease by EFRH-phage immuniza ion,”
Vaccine
,
ol. 21, no. 11–12, pp. 1060–1065, 2003, doi: 10.1016/S0264-410X(02)00609-6.
[77] A. Ksendzo sky, S. Walb idge, R. C. Saunde s, A. R. As hagi i, J. D. Heiss, and R. R. Lonse ,
“Con ec ion-enhanced deli e y o M13 bac e iophage o he b ain: Labo a o y in es iga ion,”
J
Neu osu g
, ol. 117, no. 2, pp. 197–203, 2012, doi: 10.3171/2012.4.JNS111528.
[78] A. M. Meh a, A. M. Sonabend, and J. N. B uce, “Con ec ion-Enhanced Deli e y,”
Neu o he apeu ics
, ol. 14, no. 2. Sp inge New Yo k LLC, pp. 358–371, Ap . 01, 2017. doi:
10.1007/s13311-017-0520-4.
[79] G. T. Hess
e al.
, “M13 bac e iophage display amewo k ha allows so ase-media ed
modi ica ion o su ace-accessible phage p o eins,”
Bioconjug Chem
, ol. 23, no. 7, pp. 1478–
1487, Jul. 2012, doi: 10.1021/bc300130z.
[80] Y. Wang
e al.
, “Filamen ous Bac e iophage—A Powe ul Ca ie o Glioma The apy,”
F on ie s in
Immunology
, ol. 12. F on ie s Media S.A., Sep. 10, 2021. doi: 10.3389/ immu.2021.729336.
[81] P. Mu gas
e al.
, “A ilamen ous bac e iophage a ge ed o ca cinoemb yonic an igen induces
umo eg ession in mouse models o colo ec al cance ,”
Cance Immunology, Immuno he apy
,
ol. 67, no. 2, pp. 183–193, 2018, doi: 10.1007/s00262-017-2076-x.
[82] H. Y. Wang
e al.
, “De elopmen o a No el Cy okine Vehicle Using Filamen ous Phage Display o
Colo ec al Cance T ea men ,”
ACS Syn h Biol
, ol. 10, no. 8, pp. 2087–2095, Aug. 2021, doi:
10.1021/acssynbio.1c00266.
[83] T. K. Lu and J. J. Collins, “Enginee ed bac e iophage a ge ing gene ne wo ks as adju an s o
an ibio ic he apy,” 2009. [Online]. A ailable: www.pnas.o g/cgi/con en / ull/
[84] J. W. Lee, J. Song, M. P. Hwang, and K. H. Lee, “Nanoscale bac e iophage biosenso s beyond
phage display,”
In e na ional Jou nal o Nanomedicine
, ol. 8. pp. 3917–3925, Oc . 10, 2013.
doi: 10.2147/IJN.S51894.
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
REFERENCES
83
[85] K. Li
e al.
, “Chemical modi ica ion o M13 bac e iophage and i s applica ion in cance cell
imaging,”
Bioconjug Chem
, ol. 21, no. 7, pp. 1369–1377, Jul. 2010, doi: 10.1021/bc900405q.
[86] D. Ghosh
e al.
, “M13- empla ed magne ic nanopa icles o a ge ed in i o imaging o p os a e
cance ,”
Na Nano echnol
, ol. 7, no. 10, pp. 677–682, Aug. 2012, doi:
10.1038/nnano.2012.146.
[87] T. F. Massoud and S. S. Gambhi , “Molecula imaging in li ing subjec s: Seeing undamen al
biological p ocesses in a new ligh ,”
Genes and De elopmen
, ol. 17, no. 5. pp. 545–580, Ma .
01, 2003. doi: 10.1101/gad.1047403.
[88] D. Ghosh, A. G. Kohli, F. Mose , D. Endy, and A. M. Belche , “Re ac o ed M13 bac e iophage as
a pla o m o umo cell imaging and d ug deli e y,”
ACS Syn h Biol
, ol. 1, no. 12, pp. 576–582,
Dec. 2012, doi: 10.1021/sb300052u.
[89] Z. Ju and W. Sun, “D ug deli e y ec o s based on ilamen ous bac e iophages and phage-mime ic
nanopa icles,”
D ug Deli e y
, ol. 24, no. 1. Taylo and F ancis L d, pp. 1898–1908, 2017. doi:
10.1080/10717544.2017.1410259.
[90] P. Ngweni o m, G. Abbineni, B. Cao, and C. Mao, “Sel -assembly o d ug-loaded liposomes on
gene ically enginee ed a ge - ecognizing M13 phage: A no el nanoca ie o a ge ed d ug
deli e y,”
Small
, ol. 5, no. 17, pp. 1963–1969, Sep. 2009, doi: 10.1002/smll.200801902.
[91] H. Diman , N. Sha on, and B. Solomon, “Modula ion e ec o ilamen ous phage on α-synuclein
agg ega ion,”
Biochem Biophys Res Commun
, ol. 383, no. 4, pp. 491–496, Jun. 2009, doi:
10.1016/j.bb c.2009.04.048.
[92] J. Messing, “Phage M13 o he ea men o Alzheime and Pa kinson disease,”
Gene
, ol. 583,
no. 2. Else ie B.V., pp. 85–89, Jun. 01, 2016. doi: 10.1016/j.gene.2016.02.005.
[93] R. K ishnan
e al.
, “A bac e iophage capsid p o ein p o ides a gene al amyloid in e ac ion mo i
(GAIM) ha binds and emodels mis olded p o ein assemblies,”
J Mol Biol
, ol. 426, no. 13, pp.
2500–2519, 2014, doi: 10.1016/j.jmb.2014.04.015.
[94] J. H. To pey, R. M. Meade, R. Mis y, J. M. Mason, and J. Madine, “Insigh s In o Pep ide Inhibi ion
o Alpha-Synuclein Agg ega ion,”
F on Neu osci
, ol. 14, Oc . 2020, doi:
10.3389/ nins.2020.561462.
[95] H. Che u a a, V. L. Allen-Baume, N. M. Kad, and J. M. Mason, “In acellula sc eening o a pep ide
lib a y o de i e a po en pep ide inhibi o o α-synuclein agg ega ion,”
Jou nal o Biological
Chemis y
, ol. 290, no. 12, pp. 7426–7435, Ma . 2015, doi: 10.1074/jbc.M114.620484.
[96] R. M. Meade, K. J. Mo is, K. J. C. Wa , R. J. Williams, and J. M. Mason, “The Lib a y De i ed
4554W Pep ide Inhibi s P ima y Nuclea ion o α-Synuclein,”
J Mol Biol
, ol. 432, no. 24, Dec.
2020, doi: 10.1016/j.jmb.2020.11.005.
[97] K. J. C. Wa , R. M. Meade, R. J. Williams, and J. M. Mason, “Lib a y-De i ed Pep ide Agg ega ion
Modula o s o Pa kinson’s Disease Ea ly-Onse α-Synuclein Va ian s,”
ACS Chem Neu osci
, ol.
13, no. 12, pp. 1790–1804, 2022, doi: 10.1021/acschemneu o.2c00190.
[98] R. Rangel
e al.
, “Ta ge ing mammalian o ganelles wi h in e nalizing phage (iPhage) lib a ies,”
Na
P o oc
, ol. 8, no. 10, pp. 1916–1939, 2013, doi: 10.1038/np o .2013.119.

Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
REFERENCES
84
[99] Y. Zhang, “I-TASSER se e o p o ein 3D s uc u e p edic ion,”
BMC Bioin o ma ics
, ol. 9, pp.
1–8, 2008, doi: 10.1186/1471-2105-9-40.
[100] A. Roy, A. Kucuku al, and Y. Zhang, “I-TASSER: A uni ied pla o m o au oma ed p o ein s uc u e
and unc ion p edic ion,”
Na P o oc
, ol. 5, no. 4, pp. 725–738, 2010, doi:
10.1038/np o .2010.5.
[101] J. Yang, R. Yan, A. Roy, D. Xu, J. Poisson, and Y. Zhang, “The I-TASSER sui e: P o ein s uc u e
and unc ion p edic ion,”
Na Me hods
, ol. 12, no. 1, pp. 7–8, 2014, doi: 10.1038/nme h.3213.
[102] M. L. Rei man, “O mice and men – en i onmen al empe a u e, body empe a u e, and ea men
o obesi y,”
FEBS Le
, ol. 592, no. 12, pp. 2098–2107, 2018, doi: 10.1002/1873-
3468.13070.
[103] G. Kuma , “P inciple and me hod o sil e s aining o p o eins sepa a ed by sodium dodecyl
sul a e–Polyac ylamide gel elec opho esis,”
Me hods in Molecula Biology
, ol. 1853, pp. 231–
236, 2018, doi: 10.1007/978-1-4939-8745-0_26.
[104] M. Che alle , S. Luche, and T. Rabilloud, “Sil e s aining o p o eins in polyac ylamide gels,”
Na
P o oc
, ol. 1, no. 4, pp. 1852–1858, 2006, doi: 10.1038/np o .2006.288.
[105] “Nucleic Acid,”
The mo Scien i ic
, pp. 1–30, 2010, [Online]. A ailable:
h ps://asse s. he mo ishe .com/TFS-Asse s/CAD/manuals/ s-nanod op-nucleicacid-ol - 2.pd
[106] G. Koe sie and E. Can o , “A P ac ical Guide o Analyzing Nucleic Acid Concen a ion and Pu i y
wi h Mic o olume Spec opho ome e s,”
New England Biolabs
, ol. 1, no. 1, pp. 1–8, 2019,
[Online]. A ailable: h ps://www.neb.com/-/media/ca alog/applica ion-
no es/m s_analysis_o _na_concen a ion_and_pu i y.pd ? e =be7c8e19 4d34e558527496ea
51623dc
[107] P. Passa e i, Y. Sun, T. R. Da o n, and P. G. Oppenheime , “De e mina ion and cha ac e isa ion
o he su ace cha ge p ope ies o he bac e iophage M13 o assis bio-nanoenginee ing,”
RSC
Ad
, ol. 10, no. 42, pp. 25385–25392, 2020, doi: 10.1039/d0 a04086j.
[108] R. Monjezi, B. T. Tey, C. C. Sieo, and W. S. Tan, “Pu i ica ion o bac e iophage M13 by anion
exchange ch oma og aphy,”
J Ch oma og B Analy Technol Biomed Li e Sci
, ol. 878, no. 21,
pp. 1855–1859, 2010, doi: 10.1016/j.jch omb.2010.05.028.
[109] K. L. Shaw, G. R. G imsley, G. I. Yako le , A. A. Maka o , and C. N. Pace, “The e ec o ne cha ge
on he solubili y, ac i i y, and s abili y o ibonuclease Sa,”
P o ein Science
, ol. 10, no. 6, pp.
1206–1215, 2001, doi: 10.1110/ps.440101.
[110] S. Liu
e al.
, “Phage Display A ibodies Combined wi h AuNPs@Ru(bpy)3 2+ o Ul a-Sensi i e
Elec ochemiluminescence De ec ion o Ab in,”
Chemosenso s
, ol. 10, no. 5, 2022, doi:
10.3390/chemosenso s10050184.
[111] S. B own
e al.
, “An easy- o-p epa e mini-sca old o DNA o igami,”
Nanoscale
, ol. 7, no. 40, pp.
16621–16624, 2015, doi: 10.1039/c5n 04921k.
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
ANNEXES
85
8. ANNEXES
8.1. ANNEX I- P ime s Sequences
The p ime s sequences used in PCR p ocess and in he samples sen o sequencing.
Table 19. De ailed in o ma ion abou he p ime s used.
P ime
Sequence 5’-3’
In o ma ion
Ta ge /
Templa e
#30 (Fowa d)
ATCGATCTCGATCCCGCGAA
P ime s used o sequence
o o con i m he inse ion
o he sequences o
in e es in o he plasmid
Annealing wi h
p ime 6 o p o e
inse ion o AS
inse s in o he
pe Due
#6 (Re e se)
CTAGTTATTGCTCAGCGGT
P ime s used o con i m
he inse ion o he
sequences o in e es in o
he plasmid
Annealing wi h
p ime 30 o
p o e inse ion o
AS inse s in o
he pe Due
#25 (Re e se)
CCGCCACCCTCAGAGCCACCACCCTCATTTTCAGG
P ime s used in he PCR
p ocess o ampli y he
egion o in e es o phage
DNA ha includes he
sequence o he inse o
in e es
To con i m
co ec cloning
a e in ec ion
wi h M13 Helpe
Phage. Pai wi h
23, 24 and 41.
#41 (Fowa d)
AAGGACGGCATCGTGGCCGGCGTGAAGGCC
P ime s used in he PCR
p ocess o ampli y he
egion o in e es o phage
DNA ha includes he
sequence o he
4554WN6A inse
To con i m
co ec cloning
a e in ec ion
wi h M13 Helpe
Phage. Pai wi h
25.
#42 (Fowa d)
AAGGACGGCATCGTGAACGGCGTGAAGGCC
P ime s used in he PCR
p ocess o ampli y he
egion o in e es o phage
DNA ha includes he
sequence o he 4554W
inse
To con i m
co ec cloning
a e in ec ion
wi h M13 Helpe
Phage. Pai wi h
25.
#43 (Fowa d)
AAGGAGGGCGTGGTGCACGGCGTGGCCACC
P ime s used in he PCR
p ocess o ampli y he
egion o in e es o phage
DNA ha includes he
sequence o he 4554
inse
To con i m
co ec cloning
a e in ec ion
wi h M13 Helpe
Phage. Pai wi h
25.
#7 (Re e se)
CCCTCATAGTTAGCGTAACG
P ime s used in he
samples sen o
sequencing
To sequence o
ampli y he
M13KE gene 3
a e pep ide
inse ion
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
ANNEXES
86
8.2. ANNEX II- P edic ed con o ma ional s uc u e o he pep ides
The con o ma ional s uc u e da a p o ided by he I-TASSER so wa e:
Figu e 19. A schema ic ep esen a ion o he I-TASSER p o ocol o p s uc u e [99]–[101].
Enginee ing O Speci ic Bac e iophages Fo α-Synucleinopa hies Diagnosis
ANNEXES
87
8.3. ANNEX III- Expec ed Size o PCR p oduc s by SnapGene so wa e
The ac ion, PCR, o he SnapGene so wa e was used o pe o med
in silico
he expec ed size o
PCR p oduc s:
Figu e 21. Expec ed size o PCR p oduc o ampli ica ion o gene 3 zone con aining he inse sequences: #30 – owa d
p ime and #6 – e e se p ime .
p oduc _PCR_#Pe DUe _g3_pelB#p ime s6-30
1840 bp
Figu e 20.
Expec ed size o PCR p oduc o ampli ica ion o gene 3 zone wi h p ime s #30 and #6 (nega i e con ol - emp y
phagemid): #30 – owa d p ime and #6 – e e se p ime .
Pep ide o in e es gene
p oduc _PCR_#Pe DUe _g3_pelB_inse #p ime s6-30
1858 bp