scieee AI-readable full text Open interactive document viewer

PhcrTx2, a New Crab-Paralyzing Peptide Toxin from the Sea Anemone Phymanthus crucifer

Rodríguez, Armando Alexei,Garateix, Anoland,Salceda, Emilio,Peigneur, Steve,Zaharenko, André Junqueira,Pons, Tirso,Santos, Yúlica,Arreguín, Roberto,Ständker, Ludger,Forssmann, Wolf Georg,Tytgat, Jan,Vega, Rosario,Soto, Enrique

Abstract

We are grateful to Adys Palmero Colmenares, Estrella Cuquerella, and Maylín Díaz Martínez for their technical assistance; the divers Luis Alejandre, José Ramón García and José Ramón Guerra for collecting the sea anemone specimens, Peter Højrup for his very kind gift of a GPMAW software license, Gastón Simón and for his advice on toxicity assays, Lászlo Béress and Michael Richardson for their technical support. AA Rodríguez especially thanks the Alexander von Humboldt Foundation (postdoctoral fellowship 3.2-KUB/1153731 STP), the Collaborative Research Centre 1279 funded by the German Research Foundation (DFG), the International Foundation for Science (research grants F/4082-1, F/4082-2 and travel grant), the European Molecular Biology Organization (fellowships 167-2007 and 126-2009), the Third World Academy of Sciences (research grant 06344-2007) and the Government of Veracruz (Mexico) for their financial support. This work was partially supported by CONACyT grant 169835. VIEP-BUAP to ES, PROFOCIE 2015 grant and Network CYTED BIOTOX 212RT0467 (headed by Prof. Carlos Álvarez Valcárcel). AJZ is indebted to CAPES Brazilian Agency for a post-doctoral fellowship under the Edital Toxinologia 2010. JT was supported by the following grants: G.0433.12 and GOE3414N (F.W.O. Vlaanderen), IUAP 7/10 (Inter-University Attraction Poles Program, Belgian State, Belgian Science Policy) and OT/12/081 (KULeuven).

Full text

toxins Article PhcrTx2, a New Crab-Paralyzing Peptide Toxin from the Sea Anemone Phymanthus crucifer Armando Alexei Rodríguez 1,2,*ID , Anoland Garateix 3, Emilio Salceda 4, Steve Peigneur 5ID , AndréJunqueira Zaharenko 6, Tirso Pons 7, Yúlica Santos 8, Roberto Arreguín9, Ludger Ständker 1, Wolf-Georg Forssmann 2, Jan Tytgat 5, Rosario Vega 4and Enrique Soto 4ID 1Core Facility Functional Peptidomics, Ulm University Medical Center, Albert-Einstein-Allee 47, 89081 Ulm, Germany; ludger[email protected] 2Department of Experimental and Clinical Peptide Chemistry, Hannover Medical School (MHH), Feodor-Lynen-Straße 31, D-30625 Hannover, Germany; [email protected] 3Centro de Bioproductos Marinos (CEBIMAR), Loma y 37, Alturas del Vedado, Habana CP 10600, Cuba; [email protected] 4Instituto de Fisiología, Benemérita Universidad Autónoma de Puebla, 14 sur 6301, CU, San Manuel, Puebla CP 72750, Mexico; [email protected] (E.Sa.); [email protected] (R.V.); [email protected] (E.So.) 5Toxicology & Pharmacology, University of Leuven (KU Leuven), Campus Gasthuisberg O&N2, Herestraat 49, P.O. Box 922, 3000 Leuven, Belgium; [email protected] (S.P.); Jan.T[email protected] (J.T.) 6Laboratory of Genetics, Butantan Institute, São Paulo 05503-900, Brazil; [email protected] 7Centro Nacional de Biotecnología (CNB-CSIC), Departamento de Inmunología y Oncología, C/Darwin 3, Campus de Cantoblanco, 28049 Madrid, Spain; [email protected] 8Department of Plant Pathology, Citrus Research and Education Center, University of Florida, Lake Alfred, FL 33850, USA; [email protected] 9Instituto de Química, Universidad Nacional Autónoma de México, Delegación Coyoacán, Ciudad de México 04510, Mexico; [email protected] *Correspondence: [email protected] or [email protected]; Tel.: +49-731-5006-5171 Received: 22 January 2018; Accepted: 2 February 2018; Published: 7 February 2018 Abstract: Sea anemones produce proteinaceous toxins for predation and defense, including peptide toxins that act on a large variety of ion channels of pharmacological and biomedical interest. Phymanthus crucifer is commonly found in the Caribbean Sea; however, the chemical structure and biological activity of its toxins remain unknown, with the exception of PhcrTx1, an acid-sensing ion channel (ASIC) inhibitor. Therefore, in the present work, we focused on the isolation and characterization of new P. crucifer toxins by chromatographic fractionation, followed by a toxicity screening on crabs, an evaluation of ion channels, and sequence analysis. Five groups of toxic chromatographic fractions were found, and a new paralyzing toxin was purified and named PhcrTx2. The toxin inhibited glutamate-gated currents in snail neurons (maximum inhibition of 35%, IC 50 4.7 µ M), and displayed little or no influence on voltage-sensitive sodium/potassium channels in snail and rat dorsal root ganglion (DRG) neurons, nor on a variety of cloned voltage-gated ion channels. The toxin sequence was fully elucidated by Edman degradation. PhcrTx2 is a new β -defensin-fold peptide that shares a sequence similarity to type 3 potassium channels toxins. However, its low activity on the evaluated ion channels suggests that its molecular target remains unknown. PhcrTx2 is the first known paralyzing toxin in the family Phymanthidae. Keywords: sea anemone; neutoxin; glutamate receptor; defensin-like fold; ion channels; Phymanthus crucifer Toxins 2018,10, 72; doi:10.3390/toxins10020072 www.mdpi.com/journal/toxins Toxins 2018,10, 72 2 of 22 Key Contribution: This study shows the isolation, sequencing and pharmacological characterization of PhcrTx2, the first known crab-paralyzing toxin from the sea anemone Phymanthus crucifer and its family Phymanthidae. PhcrTx2 is a new member of the defensin-fold peptide family from sea anemone. 1. Introduction Sea anemones produce a large number of proteinaceous toxins for preying on small crustaceans and fishes, and for defense against predators [ 1 , 2 ]. These toxins comprise mainly cytolysins, protease inhibitors, and a large variety of peptides acting on sodium or potassium channels; more recently, acid-sensing ion channel (ASIC) and TRPV1 channels toxins have also been discovered [ 1 ]. These peptide toxins are valuable pharmacological tools for studying the structure and function of ion channels [ 2 ], which are involved in many physiological and pathological processes. Ion channels constitute a primary site of action for many antiepileptic drugs, local anesthetics, migraine treatments, antipsychotics and mood stabilizers, antiarrhythmics, antihypertensives, and oral hypoglycemic agents [3]. The discovery of novel families of sea anemone peptide toxins [ 4 – 6 ] and the development of “omics” studies [ 7 – 14 ] have revealed a large diversity of peptides in several species. In addition, novel molecular scaffolds and post-translational modifications in sea anemone peptides have been described [ 4 , 6 , 9 , 15 ]. However, the number of known sea anemone peptide toxins is still small, considering the large variety of peptides expected from their whole peptidomes, and taking into account that only a minor fraction of the total number of known species has been analyzed. Therefore, many new peptide toxins or even new families of peptide toxins are expected to be discovered from these organisms. An approach often used for the discovery of sea anemone toxins is based on a well-known crab bioassay [ 16 – 18 ], due to the sensitivity of crustaceans to sea anemone toxins. Crab bioassay-guided purifications have allowed the discovery of more than 30 sea anemone toxins, most of them belonging to different groups of sodium channel toxins [ 16 , 19 – 27 ]. A fewer number of peptides acting on potassium channels, and also on targets to be elucidated, have been found by observations of toxicity signs induced by injection to crabs. Such peptides remain to be functionally characterized on a variety of tentative targets, not only voltage-gated ion channels, but also ligand-gated ion channels [2,21,28] , such as glutamate-gated ion channels. Glutamate is the excitatory neurotransmitter in the crustacean neuromuscular junction [ 29 ]; therefore, it has been suggested that glutamate receptor antagonists could also be found among sea anemone toxins [ 30 ]. However, to date, no peptide acting on glutamate-gated ion channels has been characterized from sea anemones, in contrast with other venomous animals such as cone snails [ 31 ] and spiders [ 32 ]. Phymanthus crucifer (Le Sueur, 1817) is a species of sea anemone that commonly inhabits the Caribbean Sea. This species is known to produce a large diversity of peptides [ 33 ]; however, only one peptide toxin has been characterized, PhcrTx1, which is an acid-sensing ion channel inhibitor presenting an inhibitor cystine knot (ICK) motif [ 6 ]. In this work, we performed a crab bioassay-guided chromatographic fractionation of the aqueous extract obtained from the sea anemone P. crucifer. Several chromatographic fractions showing crab-paralyzing activity were isolated, and a major paralyzing peptide (PhcrTx2) was purified and sequenced. This toxin showed sequence similarity to defensin-like peptides that exhibit a variety of biological activities, including crab toxicity and voltage-gated (sodium or potassium) channel inhibition. PhcrTx2 represents the first known member of the defensin-fold family of polypeptides isolated from the family Phymanthidae. This is the first study describing paralyzing toxins in this sea anemone family. Toxins 2018,10, 72 3 of 22 2. Results 2.1. Bioassay-Guided Purification of P. crucifer Toxins The aqueous extract (350 mg/90 mL 0.1 mol/L ammonium acetate) obtained from 5 g of the sea anemone homogenate showed crab-paralyzing activity, and was subjected to chromatographic fractionation. Sephadex G-50 is a low-pressure medium that has been commonly used for the group fractionation of complex samples such as sea anemone extracts, due to its suitable fractionation range (1.5 kDa to 30 kDa) for the separation of the peptide fraction from proteins, and low molecular weight compounds. The sample was fractionated by gel filtration on Sephadex G-50 M, and aliquots were taken from every other fraction (every 20 mL) for toxicity screening purposes. Due to the large number of crabs needed for determining the ED 50 or LD 50 of every toxic chromatographic fraction, and the unavailability of such a number, we focused our efforts on characterizing the toxicity of only pure compounds submitted to both chemical and pharmacological characterization. Unless stated otherwise, three crabs were used per sample at the dose of 2000 µ g/kg for biological activity screening after every chromatographic step, and only those fractions that paralyzed all of the crabs were selected for further purification/analysis. The crab-paralyzing activity was detected in the broad zone (elution volume 820–1460 mL) indicated in the chromatographic profile (Figure 1A). The low UV absorption of the crab-paralyzing fractions from Sephadex G-50 at 280 nm (Figure 1A) indicated that these are composed of low abundance peptides and proteins distributed within the fractionation range of Sephadex G-50. In addition, the low efficiency and resolution of a low-pressure medium such as Sephadex G-50 produces broad overlapping peaks, which disfavors the appearance of any notable signals coming from these low abundance molecules. As a result, these crab-paralyzing molecules, distributed within a large elution volume range, yield a flat low UV absorption zone in the chromatographic profile. On the other hand, the crab-paralyzing zone is located between two high intensity signals whose components are mostly located out of the fractionation range of the column. Molecules eluting out of the fractionation range (>30 kDa or <1.5 kDa), specifically near the void volume (550 mL) or the total volume of the column (1825 mL), tend to be poorly resolved or not separated at all. Therefore, their contributions to the UV absorption add up to yield a significant increase of signal intensity at both sides of the crab-paralyzing zone in the Sephadex G-50 chromatographic profile. The toxic fractions were pooled and applied to a Fractogel EMD SO 3− 650 M cation-exchange column (Figure 1B), and the non-retained fraction was subsequently applied to a Fractogel EMD DEAE 650 M anion-exchange column (Figure 1C). For screening purposes, small aliquots were pooled according to the following groups: fractions from 0–50 mL, 50–100 mL, 100–150 mL, 150–200 mL, 200–250 mL, 250–300 mL, 300–350 mL, and 350–400 mL elution volume. Only the pools 0–50 mL and 50–100 mL, which were from cation-exchange chromatography and anion-exchange chromatography, respectively, paralyzed all of the crabs. Then, every single fraction (1 to 20) from these pools was assayed, and those paralyzing all of the crabs were pooled as I, II, III, and IV (Figure 1B,C). The crab-paralyzing fractions (I, II, III, and IV) from ion-exchange chromatography were subsequently subjected to reversed-phase C18 HPLC (Figure 2A–D). The chromatographic fractions from RPC18-HPLC were pooled according to peak shape, and assayed on crabs. A total of 16 toxic reversed-phase chromatographic fractions were separated and analyzed by MALDI-TOF-MS. These toxic fractions were classified into five groups according to their chromatographic behavior, molecular masses, and paralyzing effects on crabs (Table 1, Supplementary Table S1). A major reversed-phase fraction (number 5 in Figure 2A) was subjected to repurification on an analytical reversed-phase C18 column (Figure 2E,F), and the pure toxin was named PhcrTx2. The amount of pure peptide was 420 µg, which represents the 0.0084% of 5 g P. crucifer freeze-dried whole homogenate. Toxins 2018,10, 72 4 of 22 Table 1. Features overview of distinct groups of toxic reversed-phase chromatographic fractions, based on chromatographic behavior, molecular masses, and crab-paralyzing activity. Three crabs were used per sample for screening purposes. Only those samples provoking death or paralysis to all of the crabs were considered lethal or paralyzing, respectively, at 2000 µg/kg. RP-HPLC Fraction Number Features Paralyzing Effects on Crab Uca thayeri 1–4 and 6 tR= 25–30 min * 1986–5671 Da ** basic peptides *** Progressive slowing down of legs movements until remaining motionless approximately after 30 min. Lethal. 5 and 7 tR= 40–45 min 5294–5296 Da basic peptides Moderate tetanic paralysis starting after 30 min from toxin administration. Partial recovery from paralysis followed by uncoordinated leg movements. Not lethal. 8 tR= 51 min 3082 Da basic peptide Severe tetanic paralysis after a few seconds, resembling the effects provoked by Nav toxins [27]. Lethal. 9–15 tR= 49–59 min 4573–9847 Da acidic peptides Severe tetanic paralysis after a few seconds, resembling the effects provoked by Nav toxins [27]. Lethal. 16 tR= 50–55 min 19,758 Da acidic protein Moderate tetanic paralysis 5 min after toxin administration. Not lethal. * In the reversed-phase HPLC separation. ** Measured by MALDI-TOF-MS (see Supplementary Table S1). *** According to their retention in ion-exchange chromatography at pH 7: the basic peptides were retained in the cation exchanger, whereas the acidic proteins and peptides were retained in the anion exchanger. In a previous work [ 6 ], PhcrTx1, an acid-sensing ion channel toxin, was isolated using the same conditions of gel filtration chromatography, cation-exchange chromatography, and reversed-phase chromatography. Figure 1A shows the crab-paralyzing zone of the gel filtration chromatographic profile, which almost completely excludes the ASICs inhibition zone from which PhcrTx1 was previously isolated [ 6 ]. Also, Figure 1B shows that the crab-paralyzing zone (pools I and II) is totally separated from the ASICs inhibition zone where PhcrTx1 was eluted [ 6 ]. Therefore, at this point after the cation-exchange chromatography, PhcrTx1 and PhcrTx2 are completely separated. Figure 2A–F show the retention time (*) of PhcrTx1 in similar conditions of reversed-phase chromatography, indicating that PhcrTx2 is more strongly retained than PhcrTx1, in contrast with its behavior in cation-exchange chromatography (pool I, Figure 1B), where it elutes much earlier than PhcrTx1 (ASICs inhibition, Figure 1B). Toxins 2018,10, 72 5 of 22 Toxins 2018, 10, x FOR PEER REVIEW 5 of 22 Figure 1. (A) Gel filtration profile of P. crucifer aqueous extract. The soluble material contained in 5 grams of whole-body homogenate (350 mg/90 mL) was fractionated on Sephadex G-50 (5 × 93 cm) at 2 mL/min using 0.1 mol/L ammonium acetate. Fractions of 20 mL each were collected; those within the elution volumes of 820 mL to 1460 mL were paralyzing to all of the crabs, and were pooled; (B) Cation-exchange chromatographic profile of the crab-paralyzing pool of chromatographic fractions from Sephadex G-50, in Fractogel EMD SO3− 650 M (1.8 × 5 cm); (C) Anion-exchange chromatographic profile of the non-retained fraction from the cation exchanger, in Fractogel EMD DEAE 650 M (1.8 × 5 cm). Both separations (B,C) were done at a flow rate of 1 mL/min using a 400-mL gradient, from 0.01 mol/L to 1 mol/L ammonium acetate. Eighty fractions of 5 mL each were collected in every chromatographic separation. Dashed lines in the ion-exchange chromatographic profiles represent the gradient of ammonium acetate. Fractions exhibiting toxicity to crabs were named I, II, III, and IV. The pools of fractions that inhibited acid-sensing ion channels are shown in both gel-filtration and cation-exchange chromatographic profiles, according to previous results with the same P. crucifer homogenate, using identical conditions [6]. PhcrTx1, an acid-sensing ion channel toxin from P. crucifer [6], eluted inhibiting pools of chromatographic fractions in the ASICs, as shown in (A,B). As shown, the crab-paralyzing zone and the ASICs inhibition zone barely overlapped in the gel filtration profile (A); and completely separated from each other in the cation-exchange profile (B). PhcrTx1 is not present among the crab-paralyzing chromatographic fractions isolated from the ion-exchange chromatographic separations. Figure 1. ( A ) Gel filtration profile of P. crucifer aqueous extract. The soluble material contained in 5 grams of whole-body homogenate (350 mg/90 mL) was fractionated on Sephadex G-50 (5 × 93 cm) at 2 mL/min using 0.1 mol/L ammonium acetate. Fractions of 20 mL each were collected; those within the elution volumes of 820 mL to 1460 mL were paralyzing to all of the crabs, and were pooled; ( B ) Cation-exchange chromatographic profile of the crab-paralyzing pool of chromatographic fractions from Sephadex G-50, in Fractogel EMD SO 3− 650 M (1.8 × 5 cm); ( C ) Anion-exchange chromatographic profile of the non-retained fraction from the cation exchanger, in Fractogel EMD DEAE 650 M (1.8 × 5 cm). Both separations ( B , C ) were done at a flow rate of 1 mL/min using a 400-mL gradient, from 0.01 mol/L to 1 mol/L ammonium acetate. Eighty fractions of 5 mL each were collected in every chromatographic separation. Dashed lines in the ion-exchange chromatographic profiles represent the gradient of ammonium acetate. Fractions exhibiting toxicity to crabs were named I, II, III, and IV. The pools of fractions that inhibited acid-sensing ion channels are shown in both gel-filtration and cation-exchange chromatographic profiles, according to previous results with the same P. crucifer homogenate, using identical conditions [ 6 ]. PhcrTx1, an acid-sensing ion channel toxin from P. crucifer [ 6 ], eluted inhibiting pools of chromatographic fractions in the ASICs, as shown in ( A , B) . As shown, the crab-paralyzing zone and the ASICs inhibition zone barely overlapped in the gel filtration profile ( A ); and completely separated from each other in the cation-exchange profile ( B ). PhcrTx1 is not present among the crab-paralyzing chromatographic fractions isolated from the ion-exchange chromatographic separations. Toxins 2018,10, 72 6 of 22 Toxins 2018, 10, x FOR PEER REVIEW 6 of 22 Figure 2. Reversed-phase chromatographic profiles of crab-paralyzing fractions from ion-exchange chromatography. (A,B) Reversed-phase chromatographic profiles of fractions I and II previously separated from cation-exchange chromatography, respectively; (C,D) Reversed-phase chromatographic profiles of fractions III and IV previously separated from anion-exchange chromatography, respectively. Conditions: Hypersil H5 ODS column (4.6 × 250 mm), flow rate 0.8 mL/min, linear gradient from 0 to 80% B in 80 min. Chromatographic fractions showing toxicity to crabs are indicated in the figure (1 to 16); (E,F) Reversed-phase chromatographic purification of fraction number 5. Conditions: Discovery RPC18 HPLC column (4.6 × 250 mm), flow rate of 1 mL/min, gradient from 10 to 20% B in 5 min, followed by 20 to 30% in 50 min. The pure toxin was named PhcrTx2. The dashed line in every chromatographic profile represents the gradient of acetonitrile. The asterisk (*) in (A–F) represent the point where PhcrTx1 elutes in the same chromatographic conditions, according to previous results [6]. 2.2. Biological Evaluation of PhcrTx2 2.2.1. Crab Toxicity Assay PhcrTx2 was evaluated by injecting several doses (62.5 µg/kg, 125 µg/kg, 250 µg/kg, 500 µg/kg, 1000 µg/kg, 2000 µg/kg, and 4000 µg/kg) to groups of six crabs. The number (and percentage) of paralyzed crabs was 0 (0%), 0 (0%), 1 (16.7%), 2 (33.3%), 4 (66.7%), 5 (83.3%), and 6 (100%) out of 6, for every mentioned dose, respectively. The toxin was not lethal, but only paralyzing, with an ED 50 = 707 µg/kg (see Supplementary Figure S1). The onset of the tetanic paralysis was observed after 30 min of toxin administration. After two hours, the crabs remained upward facing and showing uncoordinated movements of legs. 2.2.2. Effects of PhcrTx2 on Native Na v , K v and Glutamate-Gated Currents In the toxicity assays performed on crabs Uca thayeri, PhcrTx2 was not lethal but only paralyzing, indicating that it is most probably not acting on Na v , taking into account that Na v sea anemone toxins Figure 2. Reversed-phase chromatographic profiles of crab-paralyzing fractions from ion-exchange chromatography. ( A , B ) Reversed-phase chromatographic profiles of fractions I and II previously separated from cation-exchange chromatography, respectively; ( C , D ) Reversed-phase chromatographic profiles of fractions III and IV previously separated from anion-exchange chromatography, respectively. Conditions: Hypersil H5 ODS column (4.6 × 250 mm), flow rate 0.8 mL/min, linear gradient from 0 to 80% B in 80 min. Chromatographic fractions showing toxicity to crabs are indicated in the figure (1 to 16); ( E , F ) Reversed-phase chromatographic purification of fraction number 5. Conditions: Discovery RPC18 HPLC column (4.6 × 250 mm), flow rate of 1 mL/min, gradient from 10 to 20% B in 5 min, followed by 20 to 30% in 50 min. The pure toxin was named PhcrTx2. The dashed line in every chromatographic profile represents the gradient of acetonitrile. The asterisk (*) in ( A – F ) represent the point where PhcrTx1 elutes in the same chromatographic conditions, according to previous results [ 6 ]. 2.2. Biological Evaluation of PhcrTx2 2.2.1. Crab Toxicity Assay PhcrTx2 was evaluated by injecting several doses (62.5 µ g/kg, 125 µ g/kg, 250 µ g/kg, 500 µ g/kg, 1000 µ g/kg, 2000 µ g/kg, and 4000 µ g/kg) to groups of six crabs. The number (and percentage) of paralyzed crabs was 0 (0%), 0 (0%), 1 (16.7%), 2 (33.3%), 4 (66.7%), 5 (83.3%), and 6 (100%) out of 6, for every mentioned dose, respectively. The toxin was not lethal, but only paralyzing, with an ED 50 = 707 µ g/kg (see Supplementary Figure S1). The onset of the tetanic paralysis was observed after 30 min of toxin administration. After two hours, the crabs remained upward facing and showing uncoordinated movements of legs. Toxins 2018,10, 72 7 of 22 2.2.2. Effects of PhcrTx2 on Native Nav, Kvand Glutamate-Gated Currents In the toxicity assays performed on crabs Uca thayeri, PhcrTx2 was not lethal but only paralyzing, indicating that it is most probably not acting on Na v , taking into account that Na v sea anemone toxins are lethal to crabs. For example, toxins RpI, II, III, and IV (from Radianthus paumotensis), are lethal to crabs, with an LD 50 in the range between 10 µ g/kg and 90 µ g/kg, [ 26 ]; AETX II and III (from Anemonia erythraea) have LD 50 values of 0.53 µ g/kg and 0.28 µ g/kg, respectively [ 16 ]; Am I (from Antheopsis maculata) has an LD 50 of 830 mg/kg [ 21 ]. Also, the toxicity signs induced by PhcrTx2 differ from those caused by Na v toxins, by its late appearance and lower intensity. Hence, considering that crustaceans have a glutamatergic neuromuscular junction, and they are habitual preys of sea anemones, we evaluated the glutamate-induced responses in snail neurons. Additionally, given that many sea anemone (including crab-paralyzing) toxins show activity on mammalian ion channels, mainly by inhibiting voltage-gated potassium channels [ 34 , 35 ] or by delaying the inactivation of voltage-gated sodium channels [ 36 , 37 ], we carried out an additional set of experiments to evaluate the PhcrTx2 action on voltage-activated Na + and K + currents in rat dorsal root ganglion (DRG) neurons. Although some sea anemone peptides have been found to be ASIC toxins [ 4 , 6 , 38 ], PhcrTx2 is unlikely to have activity on acid-sensing ion channels from rat dorsal root ganglion neurons. The updated Figure 1B shows that the crab-paralyzing zone (where PhcrTx2 elutes) and the ASIC inhibition zone (where PhcrTx1 eluted in identical conditions [ 6 ]) in the cation-exchange chromatography are completely separated. Therefore, PhcrTx2 and the other crab-paralyzing basic peptides are not likely to exhibit ASIC inhibitory activity. Therefore, PhcrTx2 was not evaluated on these ion channels. PhcrTx2 Evaluation on Snail Neurons Recordings of the glutamate-evoked currents were performed on cultured isolated neurons from the land snail Helix aspersa. The neurons (n= 27) had a capacitance of 55 ± 14.6 pF, corresponding to an approximate cell diameter of 24–53 µ m (mean = 42 ± 6 µ m). In snail neurons voltage-clamped at negative membrane potentials ( − 100 mV), glutamate 1 mM (5 s) produced an inward current that shows a fast activation, followed by a desensitization phase that could have a variable steady-state component. We carried out a group of experiments to study glutamate-evoked currents in snail neurons (n= 5). For this purpose, 1-mM glutamate currents were elicited at different membrane potentials from − 100 mV to +80 mV (Figure 3A); the largest current was obtained at a holding potential of − 100 mV (average values about 2.6 ± 1.4 nA). The current had an average reversal potential close to 0 mV, from which the current increased until reaching a value of 0.3 ± 0.1 nA at 80 mV. The dose responses curves and all of the results that are shown and discussed in this article were consequently done at a holding potential of −100 mV. The reversal potential of the glutamate-evoked currents was around zero (Figure 3A). The sustained application of PhcrTx2 produced a significant decrease of the peak current (p ≤ 0.05, Student’s t-test) in the concentration range between 3 µ M and 30 µ M (n= 23). The inhibitory effect was concentration-dependent (Figure 3B). The concentration-response relationship had an IC 50 of 4.7 µ M. At 3 µ M, the closest value to the IC 50 tested, the inhibition was statistically significant (p ≤ 0.05, Student t-test), and it was about 20.4 ± 5.3% (n= 8, p= 0.03), while the maximum inhibition observed at the highest concentration (30 µ M) was about 37.5 ± 8.1% (n= 7, p= 0.01). The inhibitory effect on the peak current was very fast, reaching stability within about 2 min, and was fully reversible after washing the preparation (between the first and the second minute, Figure 3C). The sustained component and the current desensitization rate were not significantly affected at any toxin concentration tested; for example, at 3 µ M, the τdes in control was 174.7 ± 50.6 ms, whereas τdes in the presence of a toxin was 249.2 ±60.5 ms, p> 0.05, Student t-test, n= 9. Toxins 2018,10, 72 8 of 22 Toxins 2018, 10, x FOR PEER REVIEW 8 of 22 Figure 3. Effect of PhcrTx2 on a glutamate-evoked current in isolated snail neurons. (A) Glutamateevoked (at 1 mM of Glu) currents registered at different holding potentials (from −100 mV to +80 mV) show a current reversal at about 0 mV, indicating that it most probably is a non-selective cation permeant channel; (B) Concentration-response relationship of the inhibitory effect of PhcrTx2 on glutamate-gated currents. Data were fitted by a dose-response function with an IC50 of 4.7 µM. Each point represents the mean ± SE from four to seven neurons; (C) Representative current traces elicited by glutamate (1 mM) under control condition, in the presence of 30 µM PhcrTx2, and after washout of the toxin. An evaluation of the effect of PhcrTx2 on voltage-gated K+ currents in snail isolated cells (n = 29) in the concentration range from 3 µM to 30 µM showed the effects to be highly variable, and did not reach statistical significance. For example, 10 µM of toxin produced a significant decrease in the K+ current amplitude at the peak and at the steady state of 13.9 ± 2.1% (p = 0.001) and 16.0 ± 4.8% (p = 0.002), respectively. However, the effect at 30 µM was significant neither on the peak current nor on the steady state current. PhcrTx2 Evaluation on Rat DRG Neurons The action of PhcrTx2 was also evaluated on the voltage-dependent Na+ current in DRG neurons (Supplementary Figure S2A). The toxin caused a decrease in the amplitude of the peak current at concentration values between 1–10 µM, with an IC50 of 0.9 ± 0.2 µM (Supplementary Figure S2B). The maximal effect of the toxin on the Na+ current was 16%; this action was partially reversible after washout (≈90%). No significant effect was observed on the time course of inactivation for any of the concentrations studied. The perfusion of cells with 30 µM of PhcrTx2 while recording K+ currents produced an inhibition of the K+ currents that was concentration-dependent, with an IC50 = 6.4 ± 0.2 µM and 8.2 ± 0.7 µM for the peak current and steady-state current, respectively (n = 31; Supplementary Figure S2C–F). The maximum inhibitory effect was of 26.9 ± 4.1% in the peak current and 41.4 ± 4.8% in the steady-state current when PhcrTx2 30 µM was perfused. This effect was partially reversible (82%) after repeated washing of the preparation. 2.2.3. Effects of PhcrTx2 on Cloned Voltage-Gated Ion Channels At a concentration of 5 µM, PhcrTx2 was investigated for its activity on 10 different Kv channel isoforms and five different Nav channel isoforms expressed in X. laevis oocytes. PhcrTx2 was tested Figure 3. Effect of PhcrTx2 on a glutamate-evoked current in isolated snail neurons. ( A ) Glutamate-evoked (at 1 mM of Glu) currents registered at different holding potentials (from − 100 mV to +80 mV) show a current reversal at about 0 mV, indicating that it most probably is a non-selective cation permeant channel; ( B ) Concentration-response relationship of the inhibitory effect of PhcrTx2 on glutamate-gated currents. Data were fitted by a dose-response function with an IC 50 of 4.7 µ M. Each point represents the mean ± SE from four to seven neurons; ( C ) Representative current traces elicited by glutamate (1 mM) under control condition, in the presence of 30 µM PhcrTx2, and after washout of the toxin. An evaluation of the effect of PhcrTx2 on voltage-gated K + currents in snail isolated cells (n= 29) in the concentration range from 3 µ M to 30 µ M showed the effects to be highly variable, and did not reach statistical significance. For example, 10 µ M of toxin produced a significant decrease in the K + current amplitude at the peak and at the steady state of 13.9 ± 2.1% (p= 0.001) and 16.0 ± 4.8% (p= 0.002), respectively. However, the effect at 30 µ M was significant neither on the peak current nor on the steady state current. PhcrTx2 Evaluation on Rat DRG Neurons The action of PhcrTx2 was also evaluated on the voltage-dependent Na + current in DRG neurons (Supplementary Figure S2A). The toxin caused a decrease in the amplitude of the peak current at concentration values between 1–10 µ M, with an IC 50 of 0.9 ± 0.2 µ M (Supplementary Figure S2B). The maximal effect of the toxin on the Na + current was 16%; this action was partially reversible after washout ( ≈ 90%). No significant effect was observed on the time course of inactivation for any of the concentrations studied. The perfusion of cells with 30 µ M of PhcrTx2 while recording K + currents produced an inhibition of the K + currents that was concentration-dependent, with an IC 50 = 6.4 ± 0.2 µ M and 8.2 ± 0.7 µ M for the peak current and steady-state current, respectively (n= 31; Supplementary Figure S2C–F). The maximum inhibitory effect was of 26.9 ± 4.1% in the peak current and 41.4 ± 4.8% in the steady-state current when PhcrTx2 30 µ M was perfused. This effect was partially reversible (82%) after repeated washing of the preparation. Toxins 2018,10, 72 9 of 22 2.2.3. Effects of PhcrTx2 on Cloned Voltage-Gated Ion Channels At a concentration of 5 µ M, PhcrTx2 was investigated for its activity on 10 different K v channel isoforms and five different Na v channel isoforms expressed in X. laevis oocytes. PhcrTx2 was tested against members of the Shaker (K v 1.1, K v 1.2, K v 1.3, K v 1.4, K v 1.6, and Shaker IR), Shab (K v 2.1), Shaw (K v 3.1), Shal (K v 4.2), and Eag (K v 10.1) K v subfamilies. Furthermore, the toxin was also tested on Na v channel isoforms Na v 1.4, Na v 1.5, Na v 1.6, Na v 1.8, and DmNa v 1. No effect was observed for any of the investigated channels (Supplementary Figure S3 and Supplementary Table S2). 2.3. PhcrTx2 Sequence and Computational Analysis PhcrTx2 was subjected to automated N-terminal degradation, yielding a full sequence of 46 amino acid residues, 1 ALPCRCEGKTEYGDKWIFHGGCPNDYGYNDRCFMKPGSVCCYPKYE 46 . The protein sequence data reported in this paper appears in the UniProt Knowledgebase under the accession number C0HK75. Its theoretical average molecular mass of 5296.9 Da (assuming the formation of three disulfide bridges) is very close to the experimental value of 5296.8 Da (Figure 4), as determined by MALDI-TOF-MS. Toxins 2018, 10, x FOR PEER REVIEW 9 of 22 against members of the Shaker (Kv1.1, Kv1.2, Kv1.3, Kv1.4, Kv1.6, and Shaker IR), Shab (Kv2.1), Shaw (Kv3.1), Shal (Kv4.2), and Eag (Kv10.1) Kv subfamilies. Furthermore, the toxin was also tested on Nav channel isoforms Nav1.4, Nav1.5, Nav1.6, Nav1.8, and DmNav1. No effect was observed for any of the investigated channels (Supplementary Figure S3 and Supplementary Table S2). 2.3. PhcrTx2 Sequence and Computational Analysis PhcrTx2 was subjected to automated N-terminal degradation, yielding a full sequence of 46 amino acid residues, 1ALPCRCEGKTEYGDKWIFHGGCPNDYGYNDRCFMKPGSVCCYPKYE46. The protein sequence data reported in this paper appears in the UniProt Knowledgebase under the accession number C0HK75. Its theoretical average molecular mass of 5296.9 Da (assuming the formation of three disulfide bridges) is very close to the experimental value of 5296.8 Da (Figure 4), as determined by MALDI-TOF-MS. Figure 4. MALDI-TOF mass spectrum of PhcrTx2. An intense signal of m/z 5297.8 from the monoprotonated peptide ion [M + H]+ was detected, corresponding to a molecular mass of 5296.8 Da. The theoretical isoelectric point of PhcrTx2 is 7.61, indicating that it is a slightly basic peptide. PSI-BLAST results showed significant sequence similarity to several sea anemone toxins already annotated in non-redundant NCBI (nrNCBI) and UniProt/Swiss-Prot databases: (a) Am II (83.7% identity), a crab-paralyzing toxin from Antheopsis maculata [21]; and (b) BDS-I and BDS-II (both, 51.2% identity), which are antiviral and antihypertensive toxins that inhibit Kv3 channels, and delay the inactivation of Nav channels [34,35,39], which were isolated from Anemonia viridis. These toxins are classified within the “Defensin 4” protein family (Pfam accession: PF07936), to which PhcrTx2 is closely related, according to the search against the Pfam database [40]. PF07936 is composed of sea anemone neurotoxins BDS-I, BDS-II, APETx1 [41,42], and APETx2 [38,43], which are defensin-like folded peptides, and representative members with three-dimensional (3D) structures determined by NMR. Figure 5 shows a multiple sequence alignment of PhcrTx2 and the PF07936 members of highest similarity, according to the EMBOSS Water tool. The multiple sequence alignment indicated that PhcrTx2 has the disulfide bonding pattern Cys4-Cys40, Cys6-Cys32, and Cys22-Cys41. The toxin fits very well into the features described for β-defensins [44] such as (1) composed of 35–50 amino acid residues; (2) contain six cysteine residues linked according to the connectivity I-V, II-IV, III-VI; and (3) the last two cysteines are consecutively situated (in a CCXn pattern where n >1) near the Cterminus. Putative 3D models of PhcrTx2 were obtained by using the protein structure prediction servers Swiss-Model, Phyre2, I-Tasser, LOMETS, and RaptorX. The proposed models were evaluated according to quality values and by the similarity to their corresponding template (Supplementary Table S3). The PhcrTx2 3D-model generated by RaptorX, which is based on the BDS-I structure (PDB code: 1bds), showed slightly superior quality values compared to the average of the others. Most of the sequence regions that were predicted to contain β-strands by RaptorX matched those predicted by JNET, PSSPRED, and PSIPRED (Figure 5).The 3D model includes three antiparallel β-strands (residues 14–18 DKWIF, 30–34 DRCFM, and 37–42 GSVCCY), a loop that connects the first and Figure 4. MALDI-TOF mass spectrum of PhcrTx2. An intense signal of m/z5297.8 from the monoprotonated peptide ion [M + H] + was detected, corresponding to a molecular mass of 5296.8 Da. The theoretical isoelectric point of PhcrTx2 is 7.61, indicating that it is a slightly basic peptide. PSI-BLAST results showed significant sequence similarity to several sea anemone toxins already annotated in non-redundant NCBI (nrNCBI) and UniProt/Swiss-Prot databases: (a) Am II (83.7% identity), a crab-paralyzing toxin from Antheopsis maculata [ 21 ]; and (b) BDS-I and BDS-II (both, 51.2% identity), which are antiviral and antihypertensive toxins that inhibit K v 3 channels, and delay the inactivation of Na v channels [ 34 , 35 , 39 ], which were isolated from Anemonia viridis. These toxins are classified within the “Defensin 4” protein family (Pfam accession: PF07936), to which PhcrTx2 is closely related, according to the search against the Pfam database [ 40 ]. PF07936 is composed of sea anemone neurotoxins BDS-I, BDS-II, APETx1 [ 41 , 42 ], and APETx2 [ 38 , 43 ], which are defensin-like folded peptides, and representative members with three-dimensional (3D) structures determined by NMR. Figure 5shows a multiple sequence alignment of PhcrTx2 and the PF07936 members of highest similarity, according to the EMBOSS Water tool. The multiple sequence alignment indicated that PhcrTx2 has the disulfide bonding pattern Cys4-Cys40, Cys6-Cys32, and Cys22-Cys41. The toxin fits very well into the features described for β -defensins [ 44 ] such as (1) composed of 35–50 amino acid residues; (2) contain six cysteine residues linked according to the connectivity I-V, II-IV, III-VI; and (3) the last two cysteines are consecutively situated (in a CCXn pattern where n>1) near the C-terminus. Putative 3D models of PhcrTx2 were obtained by using the protein structure prediction servers Swiss-Model, Phyre2, I-Tasser, LOMETS, and RaptorX. The proposed models were evaluated according to quality values and by the similarity to their corresponding template (Supplementary Table S3). Toxins 2018,10, 72 16 of 22 and series resistance (80%) were electronically compensated. During the experiment, seal and series resistance were monitored to guarantee stable recording conditions. The K + currents were elicited by a single-step voltage protocol from − 100 mV (V hold ) to 0 mV during 800 ms every 8 s. Na + currents were elicited by pulses from − 100 mV (V hold ) to − 10 mV during 40 ms every 8 s. It has been reported that activation and steady-state inactivation curves shift over time in whole-cell patch clamp experiments [ 62 ]. The recordings were initiated 10–15 min after the whole-cell configuration was established, in order to minimize the effects of time-dependent shifts. To study the effects on voltage-gated Na+and K+currents, the toxin was ejected under pressure using a microinjector (Baby Bee; Bass, West Lafayette, IN, USA) from a micropipette positioned in the vicinity of the cell under recording, which was perfused with the toxin until the steady state of the effect was reached. The concentration-response curves were fitted to the Hill equation: Y = Y max × x n /(k n + x n ), where Y is the effect of the substance under study, Ymax is the maximum effect, x is the concentration of the toxin, k is the concentration that produces half the maximum effect, and n is the Hill coefficient. To define the statistical significance, the control recordings were compared with those obtained after toxin perfusion by using a paired Student’s t-test; a p ≤ 0.05 was considered as significant. Unless otherwise stated, all of the numerical data are presented as the mean ±SEM. Voltage Clamp Experiments on Isolated Snail Neurons Experiments to study glutamate-activated currents were performed in isolated neurons of the land snail Helix aspersa. The subesophageal mass of the snail was dissected, and put into the Ringer solution for snails (Supplementary Table S4) containing trypsin (2 mg/mL for 30 min, at 37 ◦ C). After enzymatic treatment, the preparation was washed with normal solution for snails, and the neurons were mechanically dissociated, plated on glass coverslips (Corning) pretreated with poly-D-lysine (Sigma-Aldrich), and placed onto 35-mm culture dishes (Corning). Neurons were maintained at room temperature (23–25 ◦ C) for at least 30 min before using, in order to allow the isolated cells to adhere to the coverslips. The whole-cell recording was carried out using the same experimental conditions that were described in Section 5.2.2. Glutamate currents were elicited by a fast glutamate application (about 40 ms) by shifting one of the three outlets of a fast change perfusion system (SF-77B, Warner Inst., Hamden, CT, USA) while keeping the cell at a holding potential (V h ) of − 100 mV. The interval between glutamate applications was one minute, to guarantee that the current completely recovered from desensitization. The pH of glutamate solution was checked before each experiment to avoid the potential activation of proton-gated currents. At the beginning of this study, experiments were designed to compare the effect of the toxin using two application protocols. No differences were observed in the toxin’s action (10 µ M) when the toxin was preapplied 10 s before and during glutamate ejection (sustained application), or when it was coapplied with glutamate. In the case of sustained application, we also did not observe significant differences in the amplitude of the current between the first pulse of glutamate and a subsequent one applied one minute later, in whose interval the perfusion of the toxin was not suspended. In view of these results, we decided to carry out the rest of the experiments using the co-application protocol. The solutions used in the experiments are depicted in Supplementary Table S4. The concentration -response curves were fitted to the Hill equation following the procedure described in Section 5.2.2. 5.2.3. Expression of Voltage-Gated Ion Channels in Xenopus laevis Oocytes and Electrophysiological Recordings For the expression of the voltage-gated potassium channels (K v 1.1, K v 1.2, K v 1.3, K v 1.4, K v 1.6, Shaker IR, K v 2.1, K v 3.1, K v 4.2, K v 10.1) and voltage-gated sodium channels (Na v 1.4, Na v 1.5, Na v 1.6, Na v 1.8 and DmNa v 1) in Xenopus laevis oocytes, the linearized plasmids were transcribed using the T7 or SP6 mMESSAGE-mMACHINE transcription kit (Ambion, Foster City, CA, USA). Toxins 2018,10, 72 17 of 22 The harvesting of stage V-VI oocytes from an anesthetized female Xenopus laevis frog was previously described [ 63 ]. Oocytes were injected with 50 nL of cRNA at a concentration of 1 ng/nL using a microinjector (Drummond Scientific, Broomall, PA, USA). The oocytes were incubated in ND96 solution (Supplementary Table S4), which was supplemented with 50 mg/L gentamycin sulfate. The use of the frogs was in accordance with the license number LA1210239. Two-electrode voltage-clamp recordings were performed at room temperature (18–22 ◦ C) using a Geneclamp 500 amplifier (Molecular Devices, USA) controlled by a pClamp data acquisition system (Axon Instruments, Union City, CA, USA). Whole-cell currents from oocytes were recorded 1–4 days after injection. Bath solution composition was ND96 (Supplementary Table S4). Voltage and current electrodes were filled with 3 M KCl. Resistances of both electrodes were kept between 0.7–1.5 M Ω . The elicited currents were filtered at 1 kHz, and sampled at 500 Hz using a four-pole low-pass Bessel filter. Leak subtraction was performed using a − P/4 protocol. K V 1.1–K V 1.6 and Shaker IR currents were evoked by 500 ms depolarizations to 0 mV followed by a 500 ms pulse to − 50 mV, from a holding potential of − 90 mV. K V 2.1, K V 3.1, and K V 4.2, currents were elicited by 500 ms pulses to +20 mV from a holding potential of −90 mV. 5.3. Mass Spectrometry and N-Terminal Sequencing The molecular mass analysis of the RP-HPLC fractions was performed with a Voyager-DE Pro matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI–TOF–MS) device (PerSeptive Biosystems, Framingham, MA, USA). The matrix solution was prepared with α -cyano-4-hydroxycinnamic acid dissolved at 5 mg/mL in mass buffer (0.1% TFA in 1:1 acetonitrile/water solution). One microliter of the sample solution and matrix solution were mixed on a 100-well stainless steel MALDI plate. Measurements were performed in linear mode. Positive ions were accelerated at 20 kV, and up to 100 laser shots were automatically accumulated per sample position. Voyager RP BioSpectrometry Workstation version 3.07.1 (PerSeptive Biosystems, USA) was used as the control software. The peptide sample was dissolved in 10% acetonitrile in water (v/v), and spotted on a glass fiber disk (Wako, Japan), which was pretreated with Sequa-brene (Sigma, USA). Sequences were determined by automated Edman degradation using a ShimadzuPPSQ-30 protein sequencer (Tokyo, Japan) according to the manufacturer’s instructions. 5.4. Computational Analyses The amino acid sequence of PhcrTx2 was submitted to different webservers for an in silico characterization. The software GPMAW 10.2 (http://www.welcome.to/gpmaw) [ 64 ] was used for the theoretical calculations of the isoelectric point and average molecular mass. Sequences and the three-dimensional (3D) structures of similar peptides were retrieved from the UniProt/Swiss-Prot and the Protein Data Bank (PDB) databases, respectively. PSI-BLAST (NCBI BLAST 2.0) (http: //www.ebi.ac.uk/Tools/sss/psiblast/) [ 65 ] and Pfam 31.0 (http://pfam.xfam.org/) [ 40 ] were used to identify PhcrTx2 homologues based on sequence similarity and domain architecture, respectively. Sequence alignments with a bit-score greater than 100 and an E-value of less than 0.001 were considered significant. The sequences mined from Pfam were selected in order of descending score, according to pairwise sequence alignments with PhcrTx2 using the EMBOSS water tool 6.6.0.0 (http://www.ebi.ac.uk/Tools/psa/emboss_water/) [ 66 ]. MAFFT v7 (using L-INS-i as iterative refinement method, http://mafft.cbrc.jp/alignment/server/) [ 67 ] and Jalview 2.8.2 (http://www. jalview.org/) [ 68 ] were used for multiple sequence alignment. Secondary structure prediction was performed with PSSpred v3 (https://zhanglab.ccmb.med.umich.edu/PSSpred) and PSIpred v3.3 (http://bioinf.cs.ucl.ac.uk/psipred/) [ 69 ]. The three-dimensional (3D) structure of PhcrTx2 was predicted by combining a comparative modeling strategy (i.e., SWISS-MODEL in the automated mode at http://swissmodel.expasy.org/workspace/index.php?func=modelling_simple1&userid=USERID& token=TOKEN [ 70 ]) with a template-free approach (i.e., Phyre2 v2.0 at http://www.sbg.bio.ic.ac.uk/ Toxins 2018,10, 72 18 of 22 phyre2 [ 71 ], I-Tasser v5.0 at https://zhanglab.ccmb.med.umich.edu/I-TASSER/ [ 72 ], LOMETS v4.0 at http://zhanglab.ccmb.med.umich.edu/LOMETS/ [ 73 ], and RaptorXat http://raptorx.uchicago. edu/ [ 74 ]). The predicted 3D models of PhcrTx2 were subjected to a series of tests for evaluating their internal consistency and reliability. Backbone conformation was evaluated by the inspection of the Psi/Phi Ramachandran plot obtained from PROCHECK analysis [ 75 ]. Packing quality of the 3D model was investigated by the calculation of the WHATCHECK Z-score value [ 76 ]. Lastly, sequence–structure compatibility was evaluated by VERIFY3D [ 77 ]. PROCHECK, WHATCHECK, and VERIFY3D were executed from the structure analysis and verification servers’ website at UCLA (https://services.mbi.ucla.edu/SAVES/). Also, we used Qmean Z-score (https://swissmodel. expasy.org/qmean/) for the absolute quality assessment of the peptide models [ 78 ]. CLIPS-4D (https://bioinf.ur.de/clips4d.php) [ 45 ] was used to distinguish structurally and functionally important residue-positions based on the multiple sequence alignment and 3D data. Swiss-PdbViewer 4.1.0 (http://www.expasy.org/spdbv/) [ 79 ] was used to visualize the PhcrTx2 3D model. The PyMOL Molecular Graphics System, Version 1.8 Schrödinger, LLC was used to visualize the electrostatic potential molecular surface of PhcrTx2. Supplementary Materials: The following are available online at www.mdpi.com/2072-6651/10/2/72/s1, Figure S1: Dose-response curve of the PhcrTx2 paralyzing activity on crabs, Figure S2: PhcrTx2 action on voltage-dependent Na + and K + currents in DRG neurons, Figure S3: Activity profile of PhcrTx2 on K v and Na v channels expressed in Xenopus laevis oocytes, Table S1: Molecular mass and retention time data of toxic reversed-phase chromatographic fractions, Table S2: Current amplitude PhcrTx2/control, Table S3: Model quality assessment and Table S4: Solutions used in the whole-cell patch/voltage clamp experiments. Acknowledgments: We are grateful to Adys Palmero Colmenares, Estrella Cuquerella, and Maylín Díaz Martínez for their technical assistance; the divers Luis Alejandre, JoséRamón García and JoséRamón Guerra for collecting the sea anemone specimens, Peter Højrup for his very kind gift of a GPMAW software license, Gastón Simón and for his advice on toxicity assays, Lászlo Béress and Michael Richardson for their technical support. AA Rodríguez especially thanks the Alexander von Humboldt Foundation (postdoctoral fellowship 3.2-KUB/1153731 STP), the Collaborative Research Centre 1279 funded by the German Research Foundation (DFG), the International Foundation for Science (research grants F/4082-1, F/4082-2 and travel grant), the European Molecular Biology Organization (fellowships 167-2007 and 126-2009), the Third World Academy of Sciences (research grant 06344-2007) and the Government of Veracruz (Mexico) for their financial support. This work was partially supported by CONACyT grant 169835. VIEP-BUAP to ES, PROFOCIE 2015 grant and Network CYTED BIOTOX 212RT0467 (headed by Prof. Carlos Álvarez Valcárcel). AJZ is indebted to CAPES Brazilian Agency for a post-doctoral fellowship under the Edital Toxinologia 2010. JT was supported by the following grants: G.0433.12 and GOE3414N (F.W.O. Vlaanderen), IUAP 7/10 (Inter-University Attraction Poles Program, Belgian State, Belgian Science Policy) and OT/12/081 (KULeuven). Author Contributions: A.A.R., A.G., E.Sa. and S.P. conceived and designed the experiments; A.A.R., A.G., E.Sa., S.P., A.J.Z., Y.S. and R.V. performed the experiments; A.A.R., A.G., E.Sa., S.P., A.J.Z., T.P., R.A., L.S., W.-G.F., J.T. and E.So. analyzed the data; A.A.R., E.So., E.Sa. and A.G. and wrote the paper. Conflicts of Interest: The authors declare no conflict of interest. The founding sponsors had no role in the design of the study; in the collection, analyses, or interpretation of data; in the writing of the manuscript, and in the decision to publish the results. References 1. Oliveira, J.S.; Fuentes-Silva, D.; King, G.F. Development of a rational nomenclature for naming peptide and protein toxins from sea anemones. Toxicon 2012,60, 539–550. [CrossRef] [PubMed] 2. Honma, T.; Shiomi, K. Peptide toxins in sea anemones: Structural and functional aspects. Mar. Biotechnol. (N. Y.) 2006,8, 1–10. [CrossRef] [PubMed] 3. Cannon, S.C. Physiologic principles underlying ion channelopathies. Neurotherapeutics 2007 ,4, 174–183. [CrossRef] [PubMed] 4. Osmakov, D.I.; Kozlov, S.A.; Andreev, Y.A.; Koshelev, S.G.; Sanamyan, N.P.; Sanamyan, K.E.; Dyachenko, I.A.; Bondarenko, D.A.; Murashev, A.N.; Mineev, K.S.; et al. Sea anemone peptide with uncommon beta-hairpin structure inhibits acid-sensing ion channel 3 (asic3) and reveals analgesic activity. J. Biol. Chem. 2013 ,288, 23116–23127. [CrossRef] [PubMed] Toxins 2018,10, 72 19 of 22 5. Peigneur, S.; Beress, L.; Moller, C.; Mari, F.; Forssmann, W.G.; Tytgat, J. A natural point mutation changes both target selectivity and mechanism of action of sea anemone toxins. FASEB J. 2012,26, 5141–5151. [CrossRef] [PubMed] 6. Rodriguez, A.A.; Salceda, E.; Garateix, A.G.; Zaharenko, A.J.; Peigneur, S.; Lopez, O.; Pons, T.; Richardson, M.; Diaz, M.; Hernandez, Y.; et al. A novel sea anemone peptide that inhibits acid-sensing ion channels. Peptides 2014,53, 3–12. [CrossRef] [PubMed] 7. Putnam, N.H.; Srivastava, M.; Hellsten, U.; Dirks, B.; Chapman, J.; Salamov, A.; Terry, A.; Shapiro, H.; Lindquist, E.; Kapitonov, V.V.; et al. Sea anemone genome reveals ancestral eumetazoan gene repertoire and genomic organization. Science 2007,317, 86–94. [CrossRef] [PubMed] 8. Sabourault, C.; Ganot, P.; Deleury, E.; Allemand, D.; Furla, P. Comprehensive est analysis of the symbiotic sea anemone, Anemonia viridis.BMC Genom. 2009,10, 333. [CrossRef] [PubMed] 9. Cassoli, J.S.; Verano-Braga, T.; Oliveira, J.S.; Montandon, G.G.; Cologna, C.T.; Peigneur, S.; Pimenta, A.M.; Kjeldsen, F.; Roepstorff, P.; Tytgat, J.; et al. The proteomic profile of Stichodactyla duerdeni secretion reveals the presence of a novel o-linked glycopeptide. J. Proteom. 2013,87, 89–102. [CrossRef] [PubMed] 10. Kozlov, S.; Grishin, E. The mining of toxin-like polypeptides from est database by single residue distribution analysis. BMC Genom. 2011,12, 88. [CrossRef] [PubMed] 11. Moran, Y.; Praher, D.; Schlesinger, A.; Ayalon, A.; Tal, Y.; Technau, U. Analysis of soluble protein contents from the nematocysts of a model sea anemone sheds light on venom evolution. Mar. Biotechnol. (N. Y.) 2013 , 15, 329–339. [CrossRef] [PubMed] 12. Zaharenko, A.J.; Ferreira, W.A., Jr.; Oliveira, J.S.; Richardson, M.; Pimenta, D.C.; Konno, K.; Portaro, F.C.; de Freitas, J.C. Proteomics of the neurotoxic fraction from the sea anemone Bunodosoma cangicum venom: Novel peptides belonging to new classes of toxins. Comp. Biochem. Physiol. Part D Genom. Proteom. 2008 ,3, 219–225. [CrossRef] [PubMed] 13. Rodriguez, A.A.; Cassoli, J.S.; Sa, F.; Dong, Z.Q.; de Freitas, J.C.; Pimenta, A.M.; de Lima, M.E.; Konno, K.; Lee, S.M.; Garateix, A.; et al. Peptide fingerprinting of the neurotoxic fractions isolated from the secretions of sea anemones Stichodactyla helianthus and Bunodosoma granulifera. New members of the apetx-like family identified by a 454 pyrosequencing approach. Peptides 2012,34, 26–38. [CrossRef] [PubMed] 14. Madio, B.; Undheim, E.A.B.; King, G.F. Revisiting venom of the sea anemone Stichodactyla haddoni: Omics techniques reveal the complete toxin arsenal of a well-studied sea anemone genus. J. Proteom. 2017 ,166, 83–92. [CrossRef] [PubMed] 15. Orts, D.J.; Moran, Y.; Cologna, C.T.; Peigneur, S.; Madio, B.; Praher, D.; Quinton, L.; De Pauw, E.; Bicudo, J.E.; Tytgat, J.; et al. Bcstx3 is a founder of a novel sea anemone toxin family of potassium channel blocker. FEBS J. 2013,280, 4839–4852. [CrossRef] [PubMed] 16. Shiomi, K.; Qian, W.H.; Lin, X.Y.; Shimakura, K.; Nagashima, Y.; Ishida, M. Novel polypeptide toxins with crab lethality from the sea anemone anemonia erythraea. Biochim. Biophys. Acta 1997 ,1335, 191–198. [CrossRef] 17. Béress, L.; Béress, R. Reinigung zweier krabbenlähmender toxine aus der seeanemone Anemonia sulcata. Kiel. Meeresforsch 1971,27, 117–127. 18. Shapiro, B.I. Purification of a toxin from tentacles of the anemone Condylactis gigantea.Toxicon 1968 ,5, 253–259. [CrossRef] 19. Maeda, M.; Honma, T.; Shiomi, K. Isolation and cdna cloning of type 2 sodium channel peptide toxins from three species of sea anemones (Cryptodendrum adhaesivum,Heterodactyla hemprichii and Thalassianthus aster) belonging to the family thalassianthidae. Comp. Biochem. Physiol. B Biochem. Mol. Biol. 2010 ,157, 389–393. [CrossRef] [PubMed] 20. Honma, T.; Kawahata, S.; Ishida, M.; Nagai, H.; Nagashima, Y.; Shiomi, K. Novel peptide toxins from the sea anemone Stichodactyla haddoni.Peptides 2008,29, 536–544. [CrossRef] [PubMed] 21. Honma, T.; Hasegawa, Y.; Ishida, M.; Nagai, H.; Nagashima, Y.; Shiomi, K. Isolation and molecular cloning of novel peptide toxins from the sea anemone Antheopsis maculata.Toxicon 2005 ,45, 33–41. [CrossRef] [PubMed] 22. Shiomi, K.; Honma, T.; Ide, M.; Nagashima, Y.; Ishida, M.; Chino, M. An epidermal growth factor-like toxin and two sodium channel toxins from the sea anemone Stichodactyla gigantea.Toxicon 2003 ,41, 229–236. [CrossRef] Toxins 2018,10, 72 20 of 22 23. Bruhn, T.; Schaller, C.; Schulze, C.; Sanchez-Rodriguez, J.; Dannmeier, C.; Ravens, U.; Heubach, J.F.; Eckhardt, K.; Schmidtmayer, J.; Schmidt, H.; et al. Isolation and characterisation of five neurotoxic and cardiotoxic polypeptides from the sea anemone Anthopleura elegantissima.Toxicon 2001 ,39, 693–702. [CrossRef] 24. Ishida, M.; Yokoyama, A.; Shimakura, K.; Nagashima, Y.; Shiomi, K. Halcurin, a polypeptide toxin from the sea anemone Halcurias sp., with a structural resemblance to type 1 and 2 toxins. Toxicon 1997 ,35, 537–544. [CrossRef] 25. Lin, X.Y.; Ishida, M.; Nagashima, Y.; Shiomi, K. A polypeptide toxin in the sea anemone Actinia equina homologous with other sea anemone sodium channel toxins: Isolation and amino acid sequence. Toxicon 1996,34, 57–65. [CrossRef] 26. Schweitz, H.; Bidard, J.N.; Frelin, C.; Pauron, D.; Vijverberg, H.P.; Mahasneh, D.M.; Lazdunski, M.; Vilbois, F.; Tsugita, A. Purification, sequence, and pharmacological properties of sea anemone toxins from radianthus paumotensis. A new class of sea anemone toxins acting on the sodium channel. Biochemistry 1985 ,24, 3554–3561. [CrossRef] [PubMed] 27. Ständker, L.; Beress, L.; Garateix, A.; Christ, T.; Ravens, U.; Salceda, E.; Soto, E.; John, H.; Forssmann, W.G.; Aneiros, A. A new toxin from the sea anemone Condylactis gigantea with effect on sodium channel inactivation. Toxicon 2006,48, 211–220. [CrossRef] [PubMed] 28. Shiomi, K. Novel peptide toxins recently isolated from sea anemones. Toxicon 2009 ,54, 1112–1118. [CrossRef] [PubMed] 29. Takeuchi, A.; Takeuchi, N. The effect on crayfish muscle of iontophoretically applied glutamate. J. Physiol. 1964,170, 296–317. [CrossRef] [PubMed] 30. Garateix, A.; Flores, A.; Garcia-Andrade, J.M.; Palmero, A.; Aneiros, A.; Vega, R.; Soto, E. Antagonism of glutamate receptors by a chromatographic fraction from the exudate of the sea anemone Phyllactis flosculifera. Toxicon 1996,34, 443–450. [CrossRef] 31. Lewis, R.J.; Dutertre, S.; Vetter, I.; Christie, M.J. Conus venom peptide pharmacology. Pharmacol. Rev. 2012 , 64, 259–298. [CrossRef] [PubMed] 32. De Figueiredo, S.G.; de Lima, M.E.; Nascimento Cordeiro, M.; Diniz, C.R.; Patten, D.; Halliwell, R.F.; Gilroy, J.; Richardson, M. Purification and amino acid sequence of a highly insecticidal toxin from the venom of the brazilian spider Phoneutria nigriventer which inhibits nmda-evoked currents in rat hippocampal neurones. Toxicon 2001,39, 309–317. [CrossRef] 33. Rodriguez, A.A.; Standker, L.; Zaharenko, A.J.; Garateix, A.G.; Forssmann, W.G.; Beress, L.; Valdes, O.; Hernandez, Y.; Laguna, A. Combining multidimensional liquid chromatography and maldi-tof-ms for the fingerprint analysis of secreted peptides from the unexplored sea anemone species Phymanthus crucifer. J. Chromatogr. B Anal. Technol. Biomed. Life. Sci. 2012,903, 30–39. [CrossRef] [PubMed] 34. Yeung, S.Y.; Thompson, D.; Wang, Z.; Fedida, D.; Robertson, B. Modulation of kv3 subfamily potassium currents by the sea anemone toxin bds: Significance for cns and biophysical studies. J. Neurosci. 2005 ,25, 8735–8745. [CrossRef] [PubMed] 35. Diochot, S.; Schweitz, H.; Beress, L.; Lazdunski, M. Sea anemone peptides with a specific blocking activity against the fast inactivating potassium channel kv3.4. J. Biol. Chem. 1998 ,273, 6744–6749. [CrossRef] [PubMed] 36. Liu, P.; Jo, S.; Bean, B.P. Modulation of neuronal sodium channels by the sea anemone peptide bds-i. J. Neurophysiol. 2012,107, 3155–3167. [CrossRef] [PubMed] 37. Llewellyn, L.E.; Norton, R.S. Binding of the sea anemone polypeptide bds ii to the voltage-gated sodium channel. Biochem. Int. 1991,24, 937–946. [PubMed] 38. Diochot, S.; Baron, A.; Rash, L.D.; Deval, E.; Escoubas, P.; Scarzello, S.; Salinas, M.; Lazdunski, M. A new sea anemone peptide, apetx2, inhibits asic3, a major acid-sensitive channel in sensory neurons. EMBO J. 2004 , 23, 1516–1525. [CrossRef] [PubMed] 39. Driscoll, P.C.; Gronenborn, A.M.; Beress, L.; Clore, G.M. Determination of the three-dimensional solution structure of the antihypertensive and antiviral protein bds-i from the sea anemone Anemonia sulcata: A study using nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing. Biochemistry 1989,28, 2188–2198. [CrossRef] [PubMed] Toxins 2018,10, 72 21 of 22 40. Punta, M.; Coggill, P.C.; Eberhardt, R.Y.; Mistry, J.; Tate, J.; Boursnell, C.; Pang, N.; Forslund, K.; Ceric, G.; Clements, J.; et al. The pfam protein families database. Nucleic Acids Res. 2012 ,40, D290–D301. [CrossRef] [PubMed] 41. Chagot, B.; Diochot, S.; Pimentel, C.; Lazdunski, M.; Darbon, H. Solution structure of apetx1 from the sea anemone Anthopleura elegantissima: A new fold for an herg toxin. Proteins 2005 ,59, 380–386. [CrossRef] [PubMed] 42. Diochot, S.; Loret, E.; Bruhn, T.; Beress, L.; Lazdunski, M. Apetx1, a new toxin from the sea anemone Anthopleura elegantissima, blocks voltage-gated human ether-a-go-go-related gene potassium channels. Mol. Pharmacol. 2003,64, 59–69. [CrossRef] [PubMed] 43. Chagot, B.; Escoubas, P.; Diochot, S.; Bernard, C.; Lazdunski, M.; Darbon, H. Solution structure of apetx2, a specific peptide inhibitor of asic3 proton-gated channels. Protein Sci. 2005 ,14, 2003–2010. [CrossRef] [PubMed] 44. Torres, A.M.; Kuchel, P.W. The beta-defensin-fold family of polypeptides. Toxicon 2004 ,44, 581–588. [CrossRef] [PubMed] 45. Janda, J.O.; Meier, A.; Merkl, R. Clips-4d: A classifier that distinguishes structurally and functionally important residue-positions based on sequence and 3d data. Bioinformatics 2013 ,29, 3029–3035. [CrossRef] [PubMed] 46. Anangi, R.; Rash, L.D.; Mobli, M.; King, G.F. Functional expression in Escherichia coli of the disulfide-rich sea anemone peptide apetx2, a potent blocker of acid-sensing ion channel 3. Mar. Drugs 2012 ,10, 1605–1618. [CrossRef] [PubMed] 47. Anangi, R.; Chen, C.C.; Lin, Y.W.; Cheng, Y.R.; Cheng, C.H.; Chen, Y.C.; Chu, Y.P.; Chuang, W.J. Expression in Pichia pastoris and characterization of apetx2, a specific inhibitor of acid sensing ion channel 3. Toxicon 2010,56, 1388–1397. [CrossRef] [PubMed] 48. Jensen, J.E.; Mobli, M.; Brust, A.; Alewood, P.F.; King, G.F.; Rash, L.D. Cyclisation increases the stability of the sea anemone peptide apetx2 but decreases its activity at acid-sensing ion channel 3. Mar. Drugs 2012 ,10, 1511–1527. [CrossRef] [PubMed] 49. Oliveira, J.S.; Fuentes-Silva, D.; Zaharenko, A.J. Sea anemone peptides. Biological activities, structure-function relationships and phylogenetic aspects. In Animal Toxins: State of the Art. Perspective in Health and Biotechnology, 1st ed.; de Lima, M.E., Pimenta, A.M., Martin-Eauclaire, M.F., Zingali, R.B., Rochat, H., Eds.; Editora UFMG: Belo, Horizonte, 2009. 50. Bosmans, F.; Tytgat, J. Sea anemone venom as a source of insecticidal peptides acting on voltage-gated Na + channels. Toxicon 2007,49, 550–560. [CrossRef] [PubMed] 51. Walker, R.J.; Roberts, C.J. The pharmacology of Limulus central neurons. Comp. Biochem. Physiol. C 1982 ,72, 391–401. [CrossRef] 52. Salceda, E.; Perez-Castells, J.; Lopez-Mendez, B.; Garateix, A.; Salazar, H.; Lopez, O.; Aneiros, A.; Standker, L.; Beress, L.; Forssmann, W.G.; et al. Cgna, a type i toxin from the giant caribbean sea anemone Condylactis gigantea shows structural similarities to both type i and ii toxins, as well as distinctive structural and functional properties(1). Biochem. J. 2007,406, 67–76. [CrossRef] [PubMed] 53. Salceda, E.; Garateix, A.; Aneiros, A.; Salazar, H.; Lopez, O.; Soto, E. Effects of apc, a sea anemone toxin, on sodium currents of mammalian neurons. Brain Res. 2006,1110, 136–143. [CrossRef] [PubMed] 54. Garateix, A.; Salceda, E.; Menendez, R.; Regalado, E.L.; Lopez, O.; Garcia, T.; Morales, R.A.; Laguna, A.; Thomas, O.P.; Soto, E. Antinociception produced by Thalassia testudinum extract bm-21 is mediated by the inhibition of acid sensing ionic channels by the phenolic compound thalassiolin b. Mol. Pain 2011 ,7, 10. [CrossRef] [PubMed] 55. Moran, Y.; Gordon, D.; Gurevitz, M. Sea anemone toxins affecting voltage-gated sodium channels—Molecular and evolutionary features. Toxicon 2009,54, 1089–1101. [CrossRef] [PubMed] 56. Gondran, M.; Eckeli, A.L.; Migues, P.V.; Gabilan, N.H.; Rodrigues, A.L. The crude extract from the sea anemone, Bunodosoma caissarum elicits convulsions in mice: Possible involvement of the glutamatergic system. Toxicon 2002,40, 1667–1674. [CrossRef] 57. Garateix, A.; Menéndez, R.; Díaz, M.; Martínez, J.R.; Más, R. Bunodosoma granulifera: Una especie de interés para el estudio de las neurotoxinas de anémonas. Biología1987,1, 15–26. 58. Blanchard, M.G.; Rash, L.D.; Kellenberger, S. Inhibition of voltage-gated Na + currents in sensory neurones by the sea anemone toxin apetx2. Br. J. Pharmacol. 2012,165, 2167–2177. [CrossRef] [PubMed] Toxins 2018,10, 72 22 of 22 59. Lee, J.Y.P.; Saez, N.J.; Cristofori-Armstrong, B.; Anangi, R.; King, G.F.; Smith, M.T.; Rash, L.D. Inhibition of acid-sensing ion channels by diminazene and apetx2 evoke partial and highly variable antihyperalgesia in a rat model of inflammatory pain. Br. J. Pharmacol. 2017. [CrossRef] [PubMed] 60. Smith, P.K.; Krohn, R.I.; Hermanson, G.T.; Mallia, A.K.; Gartner, F.H.; Provenzano, M.D.; Fujimoto, E.K.; Goeke, N.M.; Olson, B.J.; Kenk, D.C. Measurement of protein using bicinchoninic acid. Anal. Biochem. 1985 , 150, 76–85. [CrossRef] 61. Garza, A.; Lopez-Ramirez, O.; Vega, R.; Soto, E. The aminoglycosides modulate the acid-sensing ionic channel currents in dorsal root ganglion neurons from the rat. J. Pharmacol. Exp. Ther. 2010 ,332, 489–499. [CrossRef] [PubMed] 62. Salceda, E.; Lopez, O.; Zaharenko, A.J.; Garateix, A.; Soto, E. The sea anemone Bunodosoma caissarum toxin bciii modulates the sodium current kinetics of rat dorsal root ganglia neurons and is displaced in a voltage-dependent manner. Peptides 2010,31, 412–418. [CrossRef] [PubMed] 63. Liman, E.R.; Tytgat, J.; Hess, P. Subunit stoichiometry of a mammalian K + channel determined by construction of multimeric cdnas. Neuron 1992,9, 861–871. [CrossRef] 64. Peri, S.; Steen, H.; Pandey, A. Gpmaw—A software tool for analyzing proteins and peptides. Trends Biochem. Sci. 2001,26, 687–689. [CrossRef] 65. Altschul, S.F.; Madden, T.L.; Schaffer, A.A.; Zhang, J.; Zhang, Z.; Miller, W.; Lipman, D.J. Gapped blast and psi-blast: A new generation of protein database search programs. Nucleic Acids Res. 1997 ,25, 3389–3402. [CrossRef] [PubMed] 66. McWilliam, H.; Li, W.; Uludag, M.; Squizzato, S.; Park, Y.M.; Buso, N.; Cowley, A.P.; Lopez, R. Analysis tool web services from the embl-ebi. Nucleic Acids Res. 2013,41, W597–W600. [CrossRef] [PubMed] 67. Katoh, K.; Standley, D.M. Mafft multiple sequence alignment software version 7: Improvements in performance and usability. Mol. Biol. Evol. 2013,30, 772–780. [CrossRef] [PubMed] 68. Waterhouse, A.M.; Procter, J.B.; Martin, D.M.; Clamp, M.; Barton, G.J. Jalview version 2—A multiple sequence alignment editor and analysis workbench. Bioinformatics 2009,25, 1189–1191. [CrossRef] [PubMed] 69. Jones, D.T. Protein secondary structure prediction based on position-specific scoring matrices. J. Mol. Biol. 1999,292, 195–502. [CrossRef] [PubMed] 70. Arnold, K.; Bordoli, L.; Kopp, J.; Schwede, T. The swiss-model workspace: A web-based environment for protein structure homology modelling. Bioinformatics 2006,22, 195–201. [CrossRef] [PubMed] 71. Kelley, L.A.; Sternberg, M.J. Protein structure prediction on the web: A case study using the phyre server. Nat. Protoc. 2009,4, 363–371. [CrossRef] [PubMed] 72. Zhang, Y. I-tasser server for protein 3d structure prediction. BMC Bioinform. 2008 ,9, 40. [CrossRef] [PubMed] 73. Wu, S.; Zhang, Y. Lomets: A local meta-threading-server for protein structure prediction. Nucleic Acids Res. 2007,35, 3375–3382. [CrossRef] [PubMed] 74. Kallberg, M.; Wang, H.; Wang, S.; Peng, J.; Wang, Z.; Lu, H.; Xu, J. Template-based protein structure modeling using the raptorx web server. Nat. Protoc. 2012,7, 1511–1522. [CrossRef] [PubMed] 75. Laskowski, R.A.; Rullmannn, J.A.; MacArthur, M.W.; Kaptein, R.; Thornton, J.M. Aqua and procheck-nmr: Programs for checking the quality of protein structures solved by nmr. J. Biomol. NMR 1996 ,8, 477–486. [CrossRef] [PubMed] 76. Hooft, R.W.; Vriend, G.; Sander, C.; Abola, E.E. Errors in protein structures. Nature 1996 ,381, 272. [CrossRef] [PubMed] 77. Bowie, J.U.; Luthy, R.; Eisenberg, D. A method to identify protein sequences that fold into a known three-dimensional structure. Science 1991,253, 164–170. [CrossRef] [PubMed] 78. Benkert, P.; Biasini, M.; Schwede, T. Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics 2011,27, 343–350. [CrossRef] [PubMed] 79. Guex, N.; Peitsch, M.C. Swiss-model and the swiss-pdbviewer: An environment for comparative protein modeling. Electrophoresis 1997,18, 2714–2723. [CrossRef] [PubMed] © 2018 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).